KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6054
Entry
Dmel_CG6054       CDS       T00030                                 

Gene name
Su(fu)
Definition
(RefSeq) suppressor of fused
  KO
K06229  suppressor of fused
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dmel_CG6054 (Su(fu))
SSDB
Motif
Pfam: SUFU_C SUFU Seadorna_VP6
Other DBs
NCBI-GeneID: 41565
NCBI-ProteinID: NP_536750
FlyBase: FBgn0005355
UniProt: Q9VG38
Structure
PDB: 
4KMA

Position
3R
AA seq 468 aa
MAEANLDKKPEVKPPPGLKAIIDHLGQVYPNQPNPLQVTTLLKYWLGGQDPLDYISMYNY
PGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAKTEIELKQQIE
NPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLVAQDPQ
LGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSV
FELFPETLLNLQDDLEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDENNR
QLTDTQMKREEPSFPQSMSMSSNSLHKSCPLDFQAQAPNCISLDGIEITLAPGVAKYLLL
AIKDRIRHGRHFTFKAQHLALTLVAESVTGSAVTVNEPYGVLGYWIQVLIPDELVPRLME
DFRSAGLDEKCEPKERLELEWPDKNLKLIIDQPEPVLPMSLDAAPLKM
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggccgaggcgaatttggacaaaaaacctgaggtgaagcctccgccgggccttaaggcc
atcatagaccacctcgggcaggtgtaccccaaccagccgaacccgctgcaggtgaccaca
ctgctcaagtactggctgggcggtcaggatccgttggactacattagcatgtacaactat
cccggagatgtggataggaacgttccgccgcactggcactacattagtttcggactcagc
gacctacacggggacgagcgagtccacttgcgcgaggagggcgtcactcggtctggcatg
gggttcgagttgacctttcgcttggccaaaacagaaatagagctaaagcagcagattgag
aacccggaaaagccccaaagaccgcccacctggccggcgaacctgttgcaggccatcgga
cgctattgttttcaaacaggcaacgggttgtgcttcggagacaacatcccgtggcgcaag
agtctggatggcagtaccacttccaagctacagaacctgctcgtcgcccaggacccgcag
ttgggctgcatcgacactcccacgggcacggtggacttctgccagatcgtcggcgtcttt
gacgacgaacttgagcaggcatcgcgttggaacgggcgcggtgtgctcaacttccttcgc
caagatatgcaaactggcggtgattggctggtgactaacatggatcgccagatgagcgtc
ttcgaactgtttcccgaaacgctgctaaacctacaggacgatctggagaagcagggttcc
gatctggccggcgttaatgcagattttacgttccgtgagctgaaacctaccaaggaggtg
aaggaggaggtggatttccaggcgctgagcgagaagtgcgccaacgacgaaaacaatcgg
cagctgacggatacgcaaatgaaacgcgaggaaccaagctttccacaatccatgtcgatg
agcagcaattcgctgcacaagtcctgtcccctggactttcaagcgcaggcaccaaactgc
atttcactggacggtattgagattaccctcgcacctggtgtggccaagtacctcctactg
gccatcaaggatcgcatccgacatgggcgccacttcaccttcaaggctcagcatctggcg
ctcactttggtggcggaatccgtcaccggctcggcggtgacagtgaacgaaccgtacggc
gtgctgggctactggattcaggtcctgattcccgatgaactggtgccgcgcctgatggaa
gacttccgcagcgcgggcctagacgagaaatgcgagcccaaggagcgactggagctcgag
tggcccgacaagaatctgaagctgatcatcgaccagccggaacctgtgctgcccatgtcg
ctcgacgctgctcctctgaaaatgtga

DBGET integrated database retrieval system