KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6093
Entry
Dmel_CG6093       CDS       T00030                                 

Gene name
abo
Definition
(RefSeq) abnormal oocyte
  KO
K10571  de-etiolated-1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG6093 (abo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG6093 (abo)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     Dmel_CG6093 (abo)
SSDB
Motif
Pfam: Det1
Other DBs
NCBI-GeneID: 44793
NCBI-ProteinID: NP_524784
FlyBase: FBgn0000018
UniProt: Q9VKM4
Position
2L
AA seq 539 aa
MAYKKRLQSQNLVHLLQNRESGYTNVGQQPGRMPLLAYERLFYKCITPCLTIDSITIPPI
YLRKFTPDGRKLLAFSQDQRSLLIYSYGGSSCAAVGELIRQADVGSGECFSSQDTILKSR
IFERLFPTKETLNLCQGDFGLYYLHREFSVFLEEGRYAMLAAMTVVRGALPVDDYVRYPD
LFDKVDAFSYVFFLVDLKLGVVTDRLILPNDSIVIAHNHGISVFGSTVMMMSRLHQCVYV
YWVNDGKFHQQETIGPRPRDFIEKATTDFDNLDATTVLPITHIKQRVLSFLYRKINDKSG
NPTESQKSFYKNFEYIEHMIMERMHLVNNELLMLRYEERPNGTDTMPMATSPRRLYVFYT
ITGEEVVGVYPEYSVNLLQILLQFNDYMSNDRSLQFGDAPSLPMHFFLRHTFADSNESVS
VDRHTALRFNPSVPLSSQSLSSSPYLKFNEFRYDSRYVSPLEQPHRCCNDPIVFLDRATD
SIKFRLHATARRHLNPLAPRELCAFIWHPFDPLVLSIQKCMNSYVYHVHLYNHSTIVEK
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggcctacaagaagcgcctacaatcgcagaacctcgtgcatctgctgcagaaccgcgag
tccggatacaccaacgtgggccaacagccgggcaggatgccgctgttggcctacgagcgt
ctcttctacaagtgcatcacgccttgcctgacaattgactcgattaccattccgccgatc
tacctgcgcaagtttacgccggatggcagaaaactgttggccttctcgcaggatcagcgc
agtctgctcatatacagctacgggggttctagttgtgcggcggtgggtgaactgattcgc
caggcggatgtaggcagtggcgagtgcttcagtagccaggacaccatactcaagagcagg
atctttgaacgcctgtttcccacaaaagagacgctgaatctatgccaaggcgactttggc
ctctactatctgcaccgggagttcagtgtgttcctggaagagggtcgttatgccatgctg
gctgccatgaccgttgtgcgcggcgcactgccggtcgatgactacgtacggtacccagat
ctgttcgacaaagtggacgccttctcgtatgtgttctttctggtggatttgaagctaggc
gtcgtcacagatagacttatcctgcctaacgactccatcgtcattgcccacaatcatgga
atttccgtgtttggctcaacagtgatgatgatgtcccggctgcatcagtgcgtttacgtc
tattgggtgaatgacggtaagttccaccagcaggagactattggtcccaggccgagggac
tttatcgagaaggctaccacagactttgacaatcttgacgccaccacagttttgcccata
acgcacattaaacagcgcgtccttagctttctgtaccgtaaaattaatgataaaagtggc
aacccgacggaaagtcagaagtcgttttataaaaactttgagtatatagaacacatgatc
atggagagaatgcatctggtgaacaatgaacttctaatgttgcgctatgaagagcggcca
aatggtaccgataccatgcccatggctacatcaccgcgccgcttgtatgtattctacacc
ataactggcgaagaagtggttggcgtttatccggaatattccgtcaacctgctgcaaatc
ttactgcaattcaatgactacatgagcaatgatcgatcgctgcaattcggtgatgcacct
tcattgcccatgcattttttcctaaggcatacctttgcggattccaatgaatcggtctcc
gtcgatcgacatacggccttgcgcttcaaccccagcgttccactcagctcccagagcctt
tcctcgtcgccctatctaaagttcaacgaatttagatacgacagtcggtacgtgtctcct
ctggagcaaccccatcgctgctgcaacgatcctattgtgtttcttgaccgtgccacggat
tcaatcaagtttagactgcacgctacggcccgccggcatttaaatcctttggcgccacgg
gaattgtgcgcctttatttggcatccctttgacccactagtgctcagtatccagaaatgc
atgaacagctacgtctaccacgtgcacttgtataaccacagcacaatagtggaaaagtag

DBGET integrated database retrieval system