KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6146Help
Entry
Dmel_CG6146       CDS       T00030                                 

Gene name
Top1
Definition
(RefSeq) topoisomerase 1, isoform C
  KO
K03163  DNA topoisomerase I [EC:5.99.1.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dme03032]
    Dmel_CG6146 (Top1)
DNA replication proteins [BR:dme03032]
 Eukaryotic Type
  DNA Topoisomerases
   Dmel_CG6146 (Top1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Topoisom_I Topoisom_I_N Topo_C_assoc
Motif
Other DBs
NCBI-GeneID: 32458
NCBI-ProteinID: NP_001014742
FlyBase: FBgn0004924
UniProt: P30189 Q494M1
Position
X
AA seq 974 aa AA seqDB search
MSGDVAAENSIHIQNGGSCEVVQSNGVTTNGHGHHHHHHHSSSSSSSSKHKSSSKDKHRD
REREHKSSNSSSSSKEHKSSSRDKDRHKSSSSSSKHRDKDKERDGSSNSHRSGSSSSHKD
KDGSSSSKHKSSSGHHKRSSKDKERRDKDKDRGSSSSSRHKSSSSSRDKERSSSSHKSSS
SSSSSKSKHSSSRHSSSSSSKDQPSYDGVFVKPEPVSQQLMHSGSVDAFQMQQLGSYEAA
AAGTNFNGNGNVAGANYKNGYEESIVDIKKEEESFNNLSQASSCDYSMSQFRADEPPFVV
KHEQSYAEEDSTMNYNDHDDDADEMNDDEEDVPLAMRKRKQEATDRPDGGMDNDDDDDIP
LLARKKVKKEKIKKESKEKSKKRVKEEPSDDYGNVKPKKKKMKKEPEPAVSPGKRQKAKA
KVEEEEVWRWWEEEKRADGVKWSTLEHKGPVFAPRYERVPRNVRFYYDGKPLELSEETEE
AATFYAKMLNHDYCTKEVFNNNFFKDFRKSMTPREREIIKDFRKCNFQEMFNYFQAESEK
RKAASKEEKLIKKNENEALMKEFGFCMIDGHKEKIGNFRLEPPGLFRGRGEHPKMGMIKR
RIQASDVSINCGKDSKVPSPPPGSRWKEVRHDNTVTWLASWIENVQGQVKYIMLNPSSKL
KGEKDHIKYETARRLDKVIDKIRATYRDEWKSKEMRVRQRAVALYFIDKLALRAGNEKDE
DQADTVGCCSLRVEHVQLHKELNGKENVVVFDFPGKDSIRYYNEVEVEKRVFKNLELFME
HKKEGDDLFDRLNTQVLNEHLKELMEGLTAKVFRTYNASKTLQSQLDLLTDPSATVPEKL
LAYNRANRAVAILCNHQRSVPKSHEKSMENLKEKIKAKREAIEKCESEYHSRDEKKGKQL
ERLRDQLKKLELQETDRDENKTIALGTSKLNYLDPRISVAWCKKHDVPIEKIFNKTQRTK
FLWAVHMADENYRF
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgagtggggatgtggctgccgaaaatagcatccacatacaaaatggtggcagctgcgag
gtggttcaatccaacggggtgaccaccaatggacacggacaccaccaccatcatcaccac
agcagcagcagcagcagcagcagcaagcataaatcctccagcaaggacaagcatcgtgat
agggagagggagcacaagagctccaattcctccagctcgtcgaaggagcacaagagcagc
agtcgcgacaaggatcgacacaagagcagcagttcgtcgtcaaagcatcgggacaaggac
aaggagcgcgatggcagcagcaactcgcatcgcagcggctcatcgtccagccacaaggat
aaggatgggagcagcagcagcaagcacaagtcgtcgtcgggccaccacaagaggtcctcg
aaggataaggagcgacgcgataaggacaaggatcgcggcagcagttcatccagtcggcac
aagtcctcgtccagctcccgtgacaaagagcgcagcagcagcagtcacaagagcagctcc
tcttcatcctcatcgaagagcaaacattccagttcgcggcacagcagctcatcttcctcg
aaagaccagccatcgtacgatggcgtatttgttaagccggagcccgtttcccaacagctg
atgcactcgggctcggtggatgctttccagatgcaacagctcggtagctacgaagccgca
gccgccggcaccaattttaatggcaatggaaacgttgccggtgccaactataagaacggc
tacgaggaatcgatcgtagacatcaagaaggaggaggagagctttaacaatctgtcgcaa
gccagctcctgtgactactccatgtcccagtttcgtgccgatgagccgccgtttgtggtg
aagcacgagcagagctacgccgaagaggacagcaccatgaactacaatgatcacgacgac
gacgccgacgagatgaacgacgacgaggaggatgtgccgctggccatgcgcaagcgcaaa
caggaggcaaccgatcgtcctgatggcggcatggataacgacgatgacgacgacattccg
ctgctggcgcgcaagaaggttaagaaggagaagatcaagaaggagtccaaggaaaagtcc
aagaagcgggtcaaggaggagcccagcgatgattacggcaatgtcaagccgaaaaagaaa
aagatgaaaaaggagcccgagcctgccgtatcccccggcaaacgacagaaggcaaaggcc
aaggtggaggaggaggaggtttggcgatggtgggaggaggagaagcgtgccgatggcgtc
aaatggtcaacgctggagcacaagggacccgtgtttgcaccgcgatacgaacgggtgcca
cgcaatgtacggttctactacgatggcaagccgttggagctctctgaggaaacggaggag
gcagccacgttctatgccaagatgctgaaccacgactactgcaccaaggaagtgttcaat
aacaacttcttcaaggacttccgcaagtccatgacgcccagagagagggagattatcaag
gatttccgcaagtgcaacttccaggagatgttcaactacttccaagcggagtccgaaaag
cgcaaggcagccagcaaggaggagaagctgatcaagaagaacgaaaacgaggcgctgatg
aaggaattcggattctgcatgattgatgggcacaaggagaagatcggtaacttccgcctg
gagccgccaggcctgttccgcggtcgtggcgagcatcccaaaatgggcatgatcaagcgg
cgcatccaagccagcgatgtgtccattaactgtggcaaagattcaaaggtgccttcaccg
ccgcccggatctcgctggaaggaggtgcgccacgacaacacggtcacctggctggcctcc
tggatcgagaatgtgcagggacaggtcaagtacatcatgttgaatccctcctcgaaactc
aagggcgagaaggatcacattaagtacgagacggcgcgacgcctggacaaggtaatcgat
aagatacgtgccacctatcgcgacgagtggaagtccaaggagatgagggttcgccagcga
gcggtggccctttacttcatcgacaaactggcgctgagagcaggcaacgaaaaggacgag
gatcaggccgataccgtgggctgttgctcgctacgcgtggagcatgtccagctccacaag
gaactgaacggaaaggagaacgtggtggtctttgatttccccggtaaggactccattcgg
tattacaacgaggttgaggtggagaagcgcgtctttaagaacctcgaactgttcatggag
cacaagaaggagggcgacgacctcttcgatcgtctcaacacgcaggtgcttaatgagcat
ctcaaggagctgatggaaggtctcacggccaaggtattccgtacgtacaacgcatcgaaa
acactgcaaagtcagctggatctgttgaccgatccgagcgccacggtaccggaaaagctg
ttggcctacaatcgcgccaaccgtgccgtggccatcctctgtaaccatcagcgttccgtg
cccaagagccacgagaagtcaatggagaatctgaaggagaagatcaaggccaagcgggaa
gccatcgaaaaatgcgagtccgagtatcattcgagagacgagaagaagggcaaacagctg
gagcgcctaagggatcagctgaagaaactagaactacaagagactgatagagacgagaat
aagaccattgccctgggcacatctaagctaaactatcttgatccacgcatatcggtggct
tggtgtaaaaagcatgacgtgccgattgagaagatattcaacaaaacgcaaagaaccaaa
tttctgtgggccgttcatatggccgatgagaattatcgtttctaa

DBGET integrated database retrieval system