KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6215
Entry
Dmel_CG6215       CDS       T00030                                 

Gene name
CkIIalpha-i1
Definition
(RefSeq) CKII-alpha subunit interactor-1
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_jaz zf-met zf-LYAR zf-H2C2_2 zf-C2H2_4 zf-C2H2_11 UNC-79
Other DBs
NCBI-GeneID: 39721
NCBI-ProteinID: NP_524096
FlyBase: FBgn0015025
UniProt: Q9VUU3
Position
3L
AA seq 410 aa
MTEAEICKLCKDNRAIEIDLEKPKFKSANKLLQRLFDWYKIDAAILGENYCICEPCFGET
LRISESLEKWGTAQDEFHRRPIEIDDSTAFQIKLEVTSNKEEVETEKNDEENSFDQHIAE
PVKEDPLEKNEHMEIVVEESLKTASVDFFSVGLSRDGLAVTKFFKDKTQATRMLCTCCGH
VLEILTHIRMHSCKPRPNPVYYCRDCGSEFHKLHELHEHMKTMKHNKTMCGAKDLEFLCL
RCNQIFPRYFDVIRHENSVHNVSDFICVECNMSFANQGSYRRHTRSHKVKFTQQRFYECP
YKDCTSSYRVWARLMSHMSSHGLFSGFKSKVPSTQQERRLLEGKFMTLDPMKRVEPDRRK
LPYRKKSFYAKADFPESPTKCTNGGEFISLPKKISLQKGKYINLSDNSRP
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgacagaagcggaaatttgcaaactatgcaaggataaccgagcaattgagatcgatctc
gagaagcccaaattcaaatcggccaataaactgctgcaaagacttttcgattggtacaaa
attgatgctgctatcctgggggaaaattactgcatttgcgagccctgctttggagagact
ttgcgcataagcgaatccctggagaagtggggcacggcccaggacgagtttcaccggagg
cccatcgaaatagacgactccactgcatttcagatcaagttggaggtgacatcaaacaaa
gaagaggtagaaacggaaaagaatgatgaggagaattctttcgatcagcatatcgcggag
ccagtgaaggaagatccattggaaaaaaacgagcatatggagatcgtagtcgaagaatct
ttgaaaaccgcgtccgtggatttcttcagcgtgggattgtcacgcgatggcttggcagtc
accaagttcttcaaggacaagacccaagccactcggatgctgtgcacctgttgcggccat
gtgctcgaaatcctgacccacatacgcatgcattcttgtaaaccccgcccgaatccggtc
tactattgccgcgattgtggttcagagttccacaaactacacgaactacatgagcacatg
aagacgatgaaacacaacaagaccatgtgcggcgcaaaggatttggaatttctgtgcctc
agatgcaaccagatattcccacgctatttcgacgttatccgccacgagaacagcgttcac
aatgtatccgatttcatctgcgtggagtgcaacatgtccttcgctaaccaaggatcctac
aggaggcacacgaggagccataaagtcaaattcacgcagcagcgattttatgagtgccca
tataaggactgcacctcaagttatcgagtgtgggcgcgcttaatgtcgcacatgagttcc
cacggcctcttttctggattcaaaagcaaagtgccgtctacccaacaggaacgacgtctt
ctggagggcaagtttatgacgctggaccccatgaaacgggttgaacccgatcgccgaaag
ttgccataccgcaagaaaagcttttacgctaaggcagatttcccggaatccccgacgaaa
tgtaccaacggaggagagttcatcagcctgcccaagaaaatttccctgcagaagggaaaa
tacatcaatctttcggacaattcaagaccttag

DBGET integrated database retrieval system