KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6255Help
Entry
Dmel_CG6255       CDS       T00030                                 

Gene name
Scsalpha2
Definition
(RefSeq) Succinyl-coenzyme A synthetase alpha subunit 2
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00020  Citrate cycle (TCA cycle)
dme00640  Propanoate metabolism
dme01100  Metabolic pathways
dme01200  Carbon metabolism
Module
dme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dmel_CG6255 (Scsalpha2)
   00640 Propanoate metabolism
    Dmel_CG6255 (Scsalpha2)
Enzymes [BR:dme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Dmel_CG6255 (Scsalpha2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dmel_CG6255 (Scsalpha2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 42326
NCBI-ProteinID: NP_650809
FlyBase: FBgn0038708
UniProt: Q9VDW7
Position
3R
AA seq 342 aa AA seqDB search
MSLNRGSKMLLRALTPQILRRGKADYGKTVCNLKINKATKVLVQGFTGKQATFHSEESIK
YGTNIVGGVNPKKGGTEHLGKPVFKSVAEAVEKAKPDATVIFIPPPSAAEGICAAIESEI
GLIVAITEGIPQADMVRISQMLNCQEKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGVVG
IVSRSGTLTYESVHQTTNVGLGQALCVGLGGDPFNGTSFIDALKVFLSDKEIKGIVMIGE
IGGSAEEEAADFLKEKNTGCEAKPVVGFIAGQTAPPGRRMGHAGAIISGGKGAAKDKVAA
LEKAGVRMTANPCHLGSTLLEEMIRLKLVPKPNKKKAQAGKK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcactaaatcgaggaagcaagatgctcctgcgggcgttaacgccccaaattttgagg
cgtggcaaggcggactatggcaagacggtgtgcaacctgaagatcaacaaggcaacaaag
gttctagtccagggattcaccggcaagcaggccactttccactcggaggagtccataaag
tacggaaccaatatagttggcggtgtgaatcccaaaaagggaggtacggagcatctgggc
aagcccgtattcaaatcggtggcagaagctgtggagaaggcgaagccagatgccacggtg
atctttataccacctccatccgccgccgagggtatttgcgcggctatcgagagtgaaatt
ggcttgattgtggccatcaccgagggtattccccaggcggatatggtgcggatatcgcaa
atgctgaattgccaggagaagtcccgcctgctgggacccaactgtccgggaatcatctcg
ccggatcagtgcaaaatcggaataatgccgggagatatccacaagcgaggagtggtgggc
atagtctcgcggtcgggaaccctgacctacgagtccgtccatcagaccaccaacgtggga
ttgggtcaggctctttgcgttggcctcggcggggatccctttaacggaactagcttcata
gacgccctcaaagtgtttctgtccgacaaggagatcaagggcattgtcatgattggagag
attggcggatccgccgaggaagaggctgccgatttccttaaggagaagaacactggctgc
gaggccaagccagtagttggcttcattgctggacagactgctccaccgggtcgtcgaatg
ggtcacgccggcgccatcatttccggtggcaagggagcggccaaggacaaggtggccgcc
ctggagaaagcgggagtccgtatgaccgccaatccctgccacctgggctccacgctcctc
gaggaaatgatccgcctgaaactggtgcccaagccgaacaaaaagaaggctcaggccggg
aagaagtag

DBGET integrated database retrieval system