KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6281
Entry
Dmel_CG6281       CDS       T00030                                 

Gene name
Timp
Definition
(RefSeq) tissue inhibitor of metalloproteases
  KO
K16866  metalloproteinase inhibitor 3
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG6281 (Timp)
Peptidases and inhibitors [BR:dme01002]
 Peptidase inhibitors
  Family I35: timp family
   Dmel_CG6281 (Timp)
SSDB
Motif
Pfam: TIMP NTR
Other DBs
NCBI-GeneID: 41248
NCBI-ProteinID: NP_731461
FlyBase: FBgn0025879
UniProt: Q9VH14
Position
3R
AA seq 210 aa
MDLRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPG
RTTYKVHIKRTYKATSEARRMLRDGRLSTPQDDAMCGINLDLGKVYIVAGRMPTLNICSY
YKEYTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSPFGKCETNYSAC
MPHKVQTVNGVISRCRWRRTQLYRKCMSNP
NT seq 633 nt   +upstreamnt  +downstreamnt
atggatcttagaaagcatttgggtttattgacgctcctcctggtcgccgttttcgcgttt
tacggtcgcccagcggatgcctgcagctgcatgccatctcacccacagacgcacttcgcc
caggcggactacgttgtgcaactgcgagtccttcgcaaatcggataccatcgagcccggc
aggaccacctacaaagttcacatcaaacgcacctacaaggctacatccgaagcacgacga
atgctacgcgatgggcgcctgtccacgccccaagatgacgcaatgtgtggtataaatctc
gatctgggaaaagtttatatagtagcgggtaggatgccgacattaaatatatgcagctac
tacaaggagtacaccaggatgaccataacagagcgtcatggcttcagcggtggatatgcc
aaggccaccaattgcacagtaactccctgctttggagagagatgctttaagggacgaaac
tatgccgatacatgcaagtggtcgccttttggaaaatgcgagacgaactacagtgcctgc
atgccgcataaagtgcagacggtcaatggagtgatttcccgatgccgctggcgacgcacg
cagctctacagaaagtgcatgagcaatccgtaa

DBGET integrated database retrieval system