KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6289
Entry
Dmel_CG6289       CDS       T00030                                 

Symbol
Spn77Bc
Name
(RefSeq) serpin 77Bc, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 40236
NCBI-ProteinID: NP_001262103
FlyBase: FBgn0036970
UniProt: Q9VPH9
Position
3L
AA seq 416 aa
MKLGFLGLFGMVLSLRAHICANTVDTKSLLQKMTDARLQFALNLLQMESTHLNLENFAMT
PFSTWSLMIMFYEGAEGTTLKQIRDVLAIYVDYPTLRRWYEDVRAYHYLNSENTKLFSLR
YAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQGASIIINDDIDKASHAK
IFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNAGGSPAGKVEMMVQTG
KYAYVNNVKGLQADVLELPFGEHELVMIVILPKPSQRVSLVLKQLKNLGLHRLLEELEAS
KNESDVEVKLPKFDTRSVLSLEDTVYEAGLTDLRNEFADLGRMLIPTGDRGAYLSLYHQF
ARIVVDEEGLPNAVPQKSSGTNNIKFHINRPFAYLVLQRTHKLLIHSGVFREGEIQ
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgaagctcggatttctgggcctttttggcatggtgctcagtttgcgggcccatatatgt
gcaaatactgttgatacgaagagtctattacaaaaaatgacggacgcaaggcttcaattt
gccctcaacctgctgcaaatggaatccacgcatttaaacctggaaaactttgcgatgacg
ccattttccacgtggtcacttatgatcatgttctacgagggagcagaggggactaccttg
aagcagatacgtgatgtcctggcgatctatgtcgattatccaacactgcgcaggtggtac
gaggatgtccgagcttatcactatttaaattcggaaaacacaaaactgttttcgctgcgt
tacgcttactacgacgatgtaggagatttagaactcgtgaaagggtacaacagtgtagtc
ctagaaggagtaggagaaggaaatgtggttcttcgagagggtcggccaaggggtgtggac
ttcgaccagggggcgagtataattatcaacgacgatatcgacaaagcctctcatgcgaaa
atcttcagttcttatagccgtcgttcgttcaatagtacagtaactgtgctggggattact
gttagctactttaaggccaaatggaagtatccattcgataagtcccagacgaaagtggaa
cagttttacaacgccggcggctcgccggcaggtaaggtggagatgatggtgcaaacgggg
aagtatgcctacgtcaataatgtaaagggtctgcaagcggatgtcctggagctacctttt
ggggaacatgagctagtaatgatcgtcatactgccgaagccttcccagagagtaagcctg
gtgctcaaacaattgaagaacctgggactacatcgcctccttgaggaactcgaggcctcc
aagaatgaatctgatgtagaagtcaagcttcccaagttcgatacgcgatccgtactttca
ctcgaagataccgtatatgaggctggactaacggatctgagaaatgagttcgcagatcta
ggtcgcatgctgattcctaccggggacagaggtgcgtacctctccctctaccaccaattc
gccaggatcgtcgtagatgaagagggcttgcctaatgctgttccgcagaaatcttctgga
acaaataacatcaagttccatataaacaggccgtttgcataccttgtcctacaaagaaca
cacaaattgctcattcactccggagtctttcgggaaggtgagatccagtaa

DBGET integrated database retrieval system