KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6343
Entry
Dmel_CG6343       CDS       T00030                                 
Symbol
ND-42
Name
(RefSeq) NADH dehydrogenase (ubiquinone) 42 kDa subunit, isoform C
  KO
K03954  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00190  Oxidative phosphorylation
dme01100  Metabolic pathways
Module
dme_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dmel_CG6343 (ND-42)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 Thymidylate_kin TsaE Cytidylate_kin AAA_PrkA Cytidylate_kin2
Other DBs
NCBI-GeneID: 42591
NCBI-ProteinID: NP_001262821
FlyBase: FBgn0019957
UniProt: P91929 A4V383
Position
3R
AA seq 407 aa
MTAVFRVGLVRLVSRATQSPNLLQAQTNALPAAFQQRCSISGKTMRGGPRVPKAAPYPYK
TKKYSVFNAIFDKTSKRFDENSKVICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDLIY
INSYGYDMRKLDPQLPPSCRSYDVRNFCLDPSHDLAAQFQIRMYMLRYSQYIDALQHVLS
TGQGVVLERSPYSDFVFMEAMFRQGYLSRGARSVYNELRQNTIGELLKPHLVIYLDLPVD
AVKKQIKARNVDYEVQSKVFSDAYLSDLEQLYKQQYLKDISTHAELLIYDWTAGGETEVV
VEDIERIDFNQFEADIHNKKMLDWRFPLEAEWCEARIKYCHEKPDLMNYFNVPRFDVPEL
VRSADDGKVWRDVWFNAPGMKYRPGYNADMGDEGLLTKTKIGINQGI
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgaccgccgtgttccgcgtaggactggtgcggctcgtcagccgcgccacacagtcgccc
aatctactccaggcgcagacgaatgccctgcctgctgccttccagcagcgatgcagcatc
tccggcaagacgatgcgaggtggaccacgggtgcccaaggccgccccctatccgtacaag
acgaagaagtacagcgtgttcaatgctattttcgacaagacctccaagcgttttgacgag
aactccaaggtgatctgtgtggagggacccatcgcggccggcaagtcaaagttcgccaag
gaactggctgaggagctggacatggagtactatccggcagttgatctggacctaatctac
atcaattcgtacggctatgacatgaggaagttggatcctcagttgccgcccagctgccga
agctacgatgtgcgcaacttctgcctggatcccagccacgatctggctgcccagttccag
attcgcatgtacatgctgcgctattcgcagtacattgatgccctgcagcacgtccttagc
accggccagggtgttgtcctcgagcgcagcccctactcggactttgtcttcatggaggcc
atgtttcggcagggttatctgtcacgcggtgcgcgttccgtgtataatgagctccgacag
aacaccatcggggagctgctgaagccgcatttggttatctacttggatctgccggtcgat
gccgtgaagaagcagatcaaggcacgcaatgtggactacgaggtgcagtcaaaggtgttc
agcgatgcctacttgagcgatttggagcagctgtacaagcagcagtacctcaaggacatc
tccacccatgccgagctgctcatctacgactggacagccggcggtgagactgaggttgtg
gtggaggatatcgaacgcatcgacttcaaccagtttgaggccgatattcacaacaagaag
atgctcgactggcgtttcccgctggaggccgagtggtgcgaagcccgtatcaagtactgc
catgagaagcccgatctgatgaattacttcaatgtgccgcgtttcgatgtcccggagctg
gtgcgcagcgctgacgacggcaaagtctggcgtgatgtctggttcaatgctcccggcatg
aagtaccgtcctggctacaatgcagacatgggcgacgagggtctcctcaccaagacgaaa
ataggcatcaaccagggcatctag

DBGET integrated database retrieval system