KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6391
Entry
Dmel_CG6391       CDS       T00030                                 

Gene name
Aps
Definition
(RefSeq) Aps, isoform A
  KO
K07766  diphosphoinositol-polyphosphate diphosphatase [EC:3.6.1.52]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dmel_CG6391 (Aps)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.52  diphosphoinositol-polyphosphate diphosphatase
     Dmel_CG6391 (Aps)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 39226
NCBI-ProteinID: NP_648421
FlyBase: FBgn0036111
UniProt: Q7JVG2
Position
3L
AA seq 177 aa
MVKEKPNSTRIYDKDGFRRRAACICVKSENEAEVLLVTSSRRPELWIVPGGGVEPEEESS
VTAVREVLEEAGVVGDLGRCLGVFENNDHMHRTEVFVMNVTQELDEWEDSRSIGRKRQWF
TIDDALSQLALHKPTQQHYLMQLQHSKTLDNTNRVVNATHPPKLTNAATPAASPTTA
NT seq 534 nt   +upstreamnt  +downstreamnt
atggtcaaggagaagcccaactcgactcgcatctacgacaaggatggatttaggcgccgg
gctgcttgtatttgcgtgaaatcggagaatgaggcggaggtactcttggtaacctcatct
cgtcgcccggagttgtggatcgttccaggaggcggcgttgaaccagaagaggagtcatcg
gtgacagccgtgcgcgaagtgctcgaagaagccggcgtggttggcgatctgggtcgttgt
ctcggtgtattcgagaacaatgaccacatgcatcgcaccgaggtgttcgtgatgaacgtg
actcaggaactggacgagtgggaggattcgcggagcatcggtcgcaagcgccagtggttc
accatcgatgatgcactctcgcagctggcgctgcataagccgacgcagcaacactatctg
atgcagctgcagcactcgaagacgctggacaacacgaatcgcgtggtgaacgccacgcat
ccgcccaagttgaccaatgccgccaccccagccgcatctcccactacggcataa

DBGET integrated database retrieval system