KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6407Help
Entry
Dmel_CG6407       CDS       T00030                                 

Gene name
Wnt5
Definition
(RefSeq) Wnt oncogene analog 5, isoform B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04150  mTOR signaling pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG6407 (Wnt5)
   04150 mTOR signaling pathway
    Dmel_CG6407 (Wnt5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG6407 (Wnt5)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Haparin
  Morphogens
   Dmel_CG6407 (Wnt5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 32838
NCBI-ProteinID: NP_001285407
FlyBase: FBgn0010194
UniProt: P28466 X2JL29
Position
X
AA seq 1004 aa AA seqDB search
MSCYRKRHFLLWLLRAVCMLHLTARGAYATVGLQGVPTWIYLGLKSPFIEFGNQVEQLAN
SSIPLNMTKDEQANMHQEGLRKLGTFIKPVDLRDSETGFVKADLTKRLVFDRPNNITSRP
IHPIQEEMDQKQIILLDEDTDENGLPASLTDEDRKFIVPMALKNISPDPRWAATTPSPSA
LQPNAKAISTIVPSPLAQVEGDPTSNIDDLKKHILFLHNMTKTNSNFESKFVKFPSLQKD
KAKTSGAGGSPPNPKRPQRPIHQYSAPIAPPTPKVPAPDGGGVGGAAYNPGEQPIGGYYQ
NEELANNQSLLKPTDTDSHPAAGGSSHGQKNPSEPQVILLNETLSTETSIEADRSPSINQ
PKAGSPARTTKRPPCLRNPESPKCIRQRRREEQQRQRERDEWFRGQSQYMQPRFEPIIQT
INNTKRFAVSIEIPDSFKVSSEGSDGELLSRVERSQPSISSSSSSSSSSSRKIMPDYIKV
SMENNTSVTDYFKHDVVMTSADVASDREFLIKNMEEHGGAGSANSHHNDTTPTADAYSET
IDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDE
TVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGG
CGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNV
DAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEK
IKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARS
LMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKV
KINKRGRLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCA
ILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTCK
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgagttgctacagaaaaaggcactttctattgtggctcttgcgtgctgtgtgtatgttg
cacttaaccgcgagaggggcatatgccacagttgggttgcaaggagtgccgacatggata
tatctcggcctcaagtcccccttcatcgagtttggcaaccaggtggagcagctggccaat
tccagcataccactgaacatgaccaaggacgagcaggccaatatgcatcaagagggccta
cgcaagctcggtacgttcataaagccagtggacctgcgggactcggagactggcttcgtc
aaggccgatctcaccaagagactggtattcgatagaccgaacaacattacatctcgccct
attcacccgatacaggaggagatggatcagaagcagataatcctgctcgacgaggatacc
gacgagaatggcctgccagccagtctcaccgacgaggatcgcaagtttatagtgccgatg
gcgctcaagaatatatcgcccgatccacgctgggcggccactacaccgagtccctccgct
ttgcagccgaacgctaaagccatctcgaccattgtgccctcgcctctggcccaggtcgag
ggggatcccacgtccaacatcgatgacctgaagaagcacatactcttcttgcacaacatg
accaagaccaattcgaacttcgagtcgaaattcgttaaattcccgagcctgcaaaaggac
aaggccaagacatcgggagctggcggttcgccgcccaatcccaagcggccccagcggccg
attcatcagtattccgcgcccatagccccaccaacacccaaggtgcccgcgccagatggc
ggcggcgtaggaggagcagcttacaatcccggagagcagccaattggtggctactatcag
aacgaggaactagcgaataatcaatcccttcttaaaccaacagataccgactcccatcca
gcggccggcggtagcagccatggccagaagaatcccagcgagccccaggtgatactgctc
aacgagacactctccacggagacctcaatcgaagcggatcgcagtccatcgataaaccag
cccaaggcgggatcgcctgcgcgcacaacaaagcgaccaccttgcctgcgcaatcccgag
tccccgaaatgcatacgtcagcgtcggcgggaggagcaacagcggcagcgggagcgggac
gagtggttccgcggtcagtcgcagtacatgcagccccggttcgagccgatcatacagacg
attaacaatacgaagagatttgccgtatcaatcgagattccagactcctttaaagtatcc
tccgagggatcggatggggagttgctttcgcgagtcgaacgctcgcagcccagcattagt
agtagtagtagtagcagtagtagcagtagtaggaaaatcatgccagactatattaaggta
tccatggagaacaacacatccgtcacggattattttaagcacgacgttgtgatgacatcg
gcagatgtcgccagcgatagggaattccttatcaagaacatggaggagcacggaggcgct
ggctccgcgaacagtcatcacaatgatacgactccaactgcagacgcatattcggagaca
atcgatcttaatcccaataactgctatagcgcaataggtctaagcaacagccaaaagaag
caatgtgttaagcacaccagcgtgatgccggccataagtcgtggtgcccgtgccgccatc
caggagtgccagtttcagttcaagaatcgccgctggaactgcagcacaacgaacgacgag
accgtatttggtcccatgaccagcctggctgctcccgaaatggccttcatccacgccctg
gccgcggccacggtgaccagcttcatagctcgcgcctgccgggatggccaactggcctcc
tgcagctgctcccgcggcagtcgacccaaacagctccacgacgactggaagtggggcggc
tgtggcgacaacctggagttcgcctacaagttcgccacggacttcatcgattcgcgggag
aaggaaaccaatcgcgagacgcgtggcgttaagagaaaacgcgaggagatcaacaagaat
cgcatgcattccgatgacacgaatgcttttaacataggtattaaacgtaacaaaaacgta
gatgctaaaaacgatacaagtttggtagtgagaaacgttaggaaaagcactgaggctgaa
aacagtcacatactcaatgagaactttgatcagcacctattggaactagagcagcgcatt
acgaaggagatacttacatccaagatagacgaggaggagatgattaagctgcaggagaag
atcaaacaggagattgtcaacaccaagttcttcaagggtgagcagcagccgcgcaagaag
aagcgaaaaaaccagagagccgccgccgatgcgcccgcctatccgaggaacggcatcaag
gagagctacaaggatggcggcatattgccgcgcagcacggccactgtcaaggccaggagc
ctgatgaacttgcacaacaacgaggccggacgtcgggcggtgatcaagaaggccaggata
acgtgcaagtgccacggcgtgtccggctcctgcagcctgatcacctgctggcagcaattg
tcctccatccgggagattggcgactatctgcgcgagaagtacgagggcgccaccaaggtg
aagatcaacaagcgtggccgcctccagatcaaggacttgcaattcaaggtgccgaccgct
cacgatcttatttacctagacgaaagtcccgactggtgccgcaatagctatgcgctgcat
tggccgggaacgcacggacgtgtgtgccacaaaaactcgtcgggattggagagctgtgcc
atcctctgctgcggccggggctataatacgaagaacattatagttaacgaacgctgcaat
tgcaaatttcactggtgttgccaggttaaatgtgaagtttgtacgaaggtactcgaggag
cacacatgtaaatag

DBGET integrated database retrieval system