KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6438Help
Entry
Dmel_CG6438       CDS       T00030                                 

Gene name
amon
Definition
(RefSeq) amontillado
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dmel_CG6438 (amon)
Peptidases [BR:dme01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dmel_CG6438 (amon)
Chaperones and folding catalysts [BR:dme03110]
 Intramolecular chaperones
  Subtilisin family
   Dmel_CG6438 (amon)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain
Motif
Other DBs
NCBI-GeneID: 43215
NCBI-ProteinID: NP_477318
FlyBase: FBgn0023179
UniProt: Q9VBC7
Position
3R
AA seq 654 aa AA seqDB search
MAAATWSWLLAPFLLLHWASAGAGGGAGGSGAGLSGPAVFTSSFLVRFRRGVDNSFAHDV
ADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRV
KRGLRPAVPAIHGMKFDLKVGEGNRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAA
WAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTR
CAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGP
TDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISI
NSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAG
VFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAG
AMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKGTDTEVNYLEHVQAV
ISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKL
EARFNSPQTRHGNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKKAHEDKKMK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccacatggagctggctgttggccccattcctgctcctccactgggccagt
gcaggagcgggcggaggagcaggcggctcgggagcgggactgagcggccccgccgtcttt
accagctccttcctggtgcgcttccggcgcggagtggacaactcgtttgcccatgatgtg
gccgacaagtacggcttcgacaacctaggcccgctggtcggcgccgatggacacgagtat
catttcaagcaccggacccttccacatgcccgctccaggaggagtctgacgcacacacgg
gccctcaagagccatccggcggtgcatacggccgtgcaacagccgggattcaagcgggtt
aaacgtggcctgcggccggcggtgcccgccattcacggcatgaagttcgacctgaaagtt
ggcgagggcaatcggattgacgaggagcccactgacccctactttcccatgcaatggtac
ctcaagaacacgggtcagaatggcggcaaagtcaggctggatctgaatgtgcaggctgcc
tgggcccagggaatcaccgggaagaatgttacgacggccatcatggatgatggcgtggac
tacatgcatccggatctgaaattcaattataacgccgaggccagttatgacttcagcagt
aacgatccctttccgtatccccgatacaccgacgactggttcaacagccatggaactcgt
tgtgccggcgaagtggctgctgccagagataatggaatttgcggcgttggcgttgcttat
gacagcaaaatcgcaggcattcgcatgctggatcagccgtacatgacggacctaatcgag
gccaactccatgggccacgagccgcacaaaatccacatatacagcgcctcctggggtccc
accgatgatggcaagaccgtggacggtccccggaatgccaccatgcgagcgatagtccag
ggcgtcaatgagggtcgaaatggcctgggcaacatctatgtttgggcatccggcgacggc
ggcgaggaggatgactgcaattgtgacggctacgccgcctccatgtggaccatttccatt
aacagtgccattaacgacggccagaacgcccactacgacgagagctgcagctccacgctg
gcgtccacattcagcaacggagccaaggaccccaacacgggcgttgccaccacggacctc
tatggcaagtgcacgaccacccactcgggcaccagtgcggcggcgcccgaagcagcgggc
gtctttgccctggccttggaggccaatcctcagctgacttggcgggacatacagcatctg
acggtgctgacatcgaagcgcaactcgctgttcgatgccaagaaccgattccactggaca
atgaacggcgtgggcctggagttcaaccacctattcgggttcggagtgctggacgccggc
gccatggtcacactatccaagcagtggcattcagtgccaccgcgctatcattgcgaggcg
ggcgagcttacccagccacaggccattgttatgggtcgttcgctcttctgggagatcaaa
accgatgcttgcaagggcaccgacacggaggtcaactatttggaacacgtgcaggcggtg
atctcggcaaatgcctcacgacgcggggatcttgaacttttccttacatcgccaatgggc
acaaaatccatgatcctgtcgaggcgcgccaacgatgatgaccaccgcgatggcttcacc
aaatggccctttatgaccactcactcgtggggcgagtatccgcaggggacctggaaattg
gaggctcgcttcaactcgccccaaacacgacacggcaatctgctggaatggtccttggtc
ctgcatggcaccaaggaggcgccctatcgcaccctgcacccctcgtcgccgcactccaag
ctggccattgtgaagaaggcgcacgaggacaagaagatgaagtag

DBGET integrated database retrieval system