KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6463
Entry
Dmel_CG6463       CDS       T00030                                 

Gene name
ND-13B
Definition
(RefSeq) NADH dehydrogenase (ubiquinone) 13 kDa B subunit
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00190  Oxidative phosphorylation
dme01100  Metabolic pathways
Module
dme_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dmel_CG6463 (ND-13B)
SSDB
Motif
Pfam: ETC_C1_NDUFA5 FATC Phage_RpbA Complex1_LYR
Other DBs
NCBI-GeneID: 39214
NCBI-ProteinID: NP_648409
FlyBase: FBgn0047038
UniProt: Q9VTB4
Position
3L
AA seq 124 aa
MAKIIKASTGLTGLAVSTNPHHTLSALYGKILRAVSKMPQDASYRKYTEQLVKQRADSVA
QHKDITALEKAVGCGQVEELIVQAENELILARKMLGWKPWEKLVQAAPAKQWDWPPAQIM
EPKV
NT seq 375 nt   +upstreamnt  +downstreamnt
atggccaagatcattaaggcgtccacaggtttgactggactcgccgtgtccaccaatcca
caccacacgctgagtgctctgtatggcaagattctgcgggcggtgtccaagatgccacag
gacgccagctaccgcaagtacacggagcaactggtcaagcagcgcgccgattctgtggcc
caacacaaggacatcactgccctggaaaaggccgtcggttgcggtcaagtggaggagcta
attgtccaggccgagaacgagctgatccttgcgcgcaaaatgctcggctggaagccctgg
gagaagttggtccaagccgcgcctgccaagcagtgggactggccaccagcccagatcatg
gagcccaaggtttag

DBGET integrated database retrieval system