KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6502Help
Entry
Dmel_CG6502       CDS       T00030                                 

Gene name
E(z)
Definition
(RefSeq) enhancer of zeste, isoform B
  KO
K11430  [histone H3]-lysine27 N-trimethyltransferase EZH2 [EC:2.1.1.356]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00310  Lysine degradation
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG6502 (E(z))
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG6502 (E(z))
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.356  [histone H3]-lysine27 N-trimethyltransferase
     Dmel_CG6502 (E(z))
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dmel_CG6502 (E(z))
   Polycomb group proteins
    PRC2-EZH2 complex
     Dmel_CG6502 (E(z))
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET preSET_CXC
Motif
Other DBs
NCBI-GeneID: 39203
NCBI-ProteinID: NP_001137932
FlyBase: FBgn0000629
UniProt: P42124
Position
3L
AA seq 760 aa AA seqDB search
MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIRNWDEHNHNVQDLYCESKVWQA
KPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETV
LHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELE
EAAPGTATAIKTETLAKSKQGEDDGVVDVDADGESPMKLEKTDSKGDLTEVEKKETEEPL
ETEDADVKPDVEEVKDKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQE
CTPNIDGIKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKPFA
EPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNGL
TVNSAAVAEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCRQ
VYEFAQKEDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDH
PGHPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLC
QACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEII
SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDH
RIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcactaaagtgccgcccgagtggaagaggcgtgtcaagtcggagtacatcaaa
atcaggcagcagaagcgctacaaacgtgccgacgagatcaaggaggcgtggataagaaac
tgggacgagcacaaccacaatgtacaggatctgtactgcgagtcgaaggtttggcaggct
aaaccctacgatccgccgcatgtggactgtgtgaagcgggcggaggtgactagctacaat
ggcattcccagcggtccgcaaaaggtgcccatttgcgtgatcaacgcggtcactcccata
cccaccatgtacacgtgggcaccaacacagcagaacttcatggtggaggatgagacggtg
ctgcacaatataccctatatgggcgacgaggtcctcgataaggatggcaagttcatagag
gaactgatcaaaaactacgatggcaaggttcacggcgacaaggatccctcgttcatggac
gatgccatcttcgtagaactggtgcacgcccttatgcgctcctacagcaaggaactggag
gaagccgctccgggtacagcgactgccattaaaacagagacgttggcgaaatcaaaacag
ggcgaagatgatggggtagttgatgttgacgcagatggtgaatctcccatgaagcttgag
aaaaccgacagcaaaggggatctgactgaagttgagaagaaggaaactgaagaaccgctg
gagactgaagatgcggatgttaagcccgatgtggaagaagtcaaggacaagctgcccttc
cctgcgcccattatttttcaggccatcagcgctaactttccagacaagggcaccgcgcaa
gagctcaaagaaaagtacattgagcttacggagcaccaggatccggagcgcccacaggag
tgcacacccaacattgacggcatcaaggccgagagcgtttcccgggaaaggactatgcac
tcctttcacacgctcttctgtcgtcgttgcttcaaatacgactgcttcctgcaccgcttg
caaggacatgcgggtcccaatctccagaagcgtcgctatccggaactgaagcctttcgcc
gaaccttgcagcaactcctgctacatgttgatcgatggcatgaaggaaaagctggcggcc
gatagcaagacacctcccattgattcctgcaatgaggccagctccgaggacagtaatgac
agcaacagtcagtttagcaacaaggactttaatcatgagaatagcaaggataatggcctg
actgtaaatagcgccgctgtggctgagatcaactccattatggctggcatgatgaacatc
accagtacgcagtgcgtttggacaggcgctgaccaagcactttatcgggtcttgcataaa
gtgtatttaaagaactactgcgcgattgcgcacaacatgctgaccaagacctgtcgtcag
gtgtacgagtttgcccagaaggaggatgctgagtttagcttcgaggatttgcgacaggac
ttcacacctccgcgcaagaagaagaagaagcaacgtctgtggtcgctgcactgtcgtaag
attcagctaaagaaggactcatcctcgaatcacgtgtacaactacacgccctgcgaccat
cccggacatccatgcgacatgaactgctcctgcattcagacacaaaacttctgcgaaaag
ttctgcaactgcagcagcgattgccagaatcgtttccccggctgtcgctgcaaggctcag
tgcaatacgaagcagtgtccttgctatctggcagtgcgcgagtgtgatcccgatctgtgc
caggcctgcggagcggatcagtttaagctgaccaagatcacgtgcaagaacgtgtgcgtg
cagcgaggactgcacaagcacctgctcatggctccgtctgacatcgccggctggggcatc
tttcttaaggagggtgcgcaaaagaatgagttcatttcggaatattgtggcgagatcata
tcccaagatgaagccgatcgccgtggcaaggtttacgacaagtacatgtgctcatttctt
ttcaatctgaacaacgattttgttgtggatgccactcggaagggcaacaagattcggttt
gccaatcattccattaatcccaattgctatgccaaggttatgatggtcaccggcgatcat
cgcatcggcatctttgccaagcgggccattcagcccggcgaagagctattctttgactac
agatacggacccacggagcagctgaagttcgtgggcatagagcgtgaaatggaaattgtt
tga

DBGET integrated database retrieval system