KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6608
Entry
Dmel_CG6608       CDS       T00030                                 

Gene name
Tpc1
Definition
(RefSeq) thiamine pyrophosphate carrier protein 1, isoform A
  KO
K15108  solute carrier family 25 (mitochondrial thiamine pyrophosphate transporter), member 19
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG6608 (Tpc1)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   Dmel_CG6608 (Tpc1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 41316
NCBI-ProteinID: NP_650034
FlyBase: FBgn0037852
UniProt: Q7K0L7
Position
3R
AA seq 332 aa
MAVTTGSTSEATTTTTPVPRRKHSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQV
EPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQVLSIMYGICQFWTY
EQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLIAQDTSKGYRNATR
AVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTL
LGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVR
GLYKGVAPTLLKSSMTTALYFSIYDKLKQVRF
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcggtaaccacaggctccaccagtgaggcgaccacaaccacaactcccgttccgcga
cgcaagcacagtacgcgggagcagctgcatcaaatgctggccggtggactttcggcggcc
attacgcgctccacctgccagccgctggacgtgctaaagatccgcttccagctgcaggtg
gagccgctgggcaagaacgccgccaaggagggaccaggagcccttacctccaaatacaca
tccatcggacaggcggtgaaaaccatataccgcgaggagggaatgttggccttctggaag
ggacacaatcctgcccaagtgctgagcataatgtacggcatttgtcagttctggacgtac
gagcagctcagcctgatggccaaacagaccagctatctggcggatcatcagcatctatcg
aacttcctgtgcggcgctgcggccggaggagcagcagtgatcatatccacgccgctggac
gtcatccgcactcgtctgattgcccaggacaccagcaagggatacaggaatgcaacaagg
gctgtgtcggcgattgtccgccaggagggacctcgcggcatgtaccgcggtctgtcctcc
gccctgctgcaaataacgccgctgatgggcaccaactttatggcttaccgcctgttcagc
gactgggcgtgtgccttcttggaggtgagcgatcgcagccaattgcccacgtggacgctg
ctgggattgggcgcctcctcgggcatgctatccaagacgatcgtgtatcccttcgatttg
atcaaaaagcgactgcaaatccagggcttcgagtcgaatcgccagaccttcggacagaca
ctgcagtgccacggagtctgggactgtttgcggctgaccgtgcgccaagagggcgttagg
ggcttgtacaagggcgtggcccccacactccttaagtcaagcatgacgacggccctgtac
ttcagcatttacgataagctcaagcaggtgcgcttctag

DBGET integrated database retrieval system