KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6612
Entry
Dmel_CG6612       CDS       T00030                                 

Gene name
Adk3
Definition
(RefSeq) adenylate kinase 3, isoform C
  KO
K00944  nucleoside-triphosphate--adenylate kinase [EC:2.7.4.10]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00230  Purine metabolism
Module
dme_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG6612 (Adk3)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.10  nucleoside-triphosphate---adenylate kinase
     Dmel_CG6612 (Adk3)
SSDB
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 AAA_18 ABC_tran Zeta_toxin AAA_28
Other DBs
NCBI-GeneID: 41318
NCBI-ProteinID: NP_001287279
FlyBase: FBgn0042094
UniProt: Q9VGU6
Position
3R
AA seq 216 aa
MFTKIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAE
GKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVII
DRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSP
VIAWYEKKGLVATFKGKQTKEIWPMMELFLNDRINA
NT seq 651 nt   +upstreamnt  +downstreamnt
atgtttacgaaaatctttcgcgctgtgataatcggagcccccggctcgggcaaaggaact
atttcggaattgatctgcaagaaccatggatgtgtgcacatctccacgggggacattctg
cgccagaacatcataaaaaacacagaacttggaaaaaaggccaagcagtacattgctgaa
ggtaaactggtgcccgacgcgattgtgaccaagacgatgctggcccggataaccgaggta
ggcaacaggtcgtacatcctagacggattcccgcgcaatatagcccaggccgaggcactg
gctgcacgcgagcaaatcgatgccgtgatcacgctggacgttccacatagtgtgattatc
gaccgggtcaagaatcgctggatccatgcgccctccggcagggtgtacaatattggcttc
aagaatcccaaagtgcctggcaaagatgatgtgacgggggagccgctgatgcaacgcgaa
gatgataaaccccatgtggtggccaagcgactggagctctacgatgaggtgatgagcccg
gtaatagcctggtacgaaaagaagggtctggttgccactttcaagggaaaacagacaaag
gagatctggccgatgatggagcttttcctcaacgaccgcataaatgcgtaa

DBGET integrated database retrieval system