KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6658
Entry
Dmel_CG6658       CDS       T00030                                 
Symbol
Ugt302K1
Name
(RefSeq) UDP-glycosyltransferase family 302 member K1, isoform B
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00053  Ascorbate and aldarate metabolism
dme00830  Retinol metabolism
dme00860  Porphyrin metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
dme01240  Biosynthesis of cofactors
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG6658 (Ugt302K1)
   00053 Ascorbate and aldarate metabolism
    Dmel_CG6658 (Ugt302K1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG6658 (Ugt302K1)
   00860 Porphyrin metabolism
    Dmel_CG6658 (Ugt302K1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG6658 (Ugt302K1)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG6658 (Ugt302K1)
   00983 Drug metabolism - other enzymes
    Dmel_CG6658 (Ugt302K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dme01003]
    Dmel_CG6658 (Ugt302K1)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG6658 (Ugt302K1)
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG6658 (Ugt302K1)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3
Other DBs
NCBI-GeneID: 53502
NCBI-ProteinID: NP_001287281
FlyBase: FBgn0040251
UniProt: Q9VGT5
Position
3R
AA seq 519 aa
MRTFTLILGLLCSLGYSSGYNYLMVLNSAGRSHFNVGHALAKGLVKAGHTITVVSVFPQK
KPIPGYTDVSVPNVIEVMGGDIGALWASIQKTYTQNLIDHYQMGFRITRGLFEDSNFQDF
LKSNQSFDAIICETFYNDAHYGLAEHFNAPLIGLATGGGLTFITDMVGSPAPASFVPHIM
LPFNDHMSLYERLLNVAFLGYERVLLDYYFLPTQEKLYKEFFPGNKRCFYKMRRNASLVL
INQHVSLSFPRPHSPNMIEVGGMHIDGKWNPLPEKIERFINESEHGAIYFSMGSNLKTKD
LPPSKVQEILKALGGLKQRVLWKFELDNLPNKPENVYISDWFPQTDILAHPKIMAFVTHG
GMLSTTESIYHAKPVIGLPIFSDQFFNMAHAEQNGYGIMLDFKTLNAVEFRKAIERITSE
PSYTKVVQGISFRYRDQQQTPIENAIYWVEHVTRHQGAAYLKSAAQRLNWWQYHNVDVLL
IIFVVMVLLLIVLPITIYKLLKKLLLKGERTQSTKVKRN
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgcgtacgttcaccttgatcttgggactattgtgcagcttgggatactcaagtggatac
aattacctgatggttctgaattccgccggtcgttcccactttaatgtgggacacgctttg
gccaagggattggtcaaggctgggcatacaatcaccgtagtgtccgtctttcctcagaaa
aaacccattcctggttatactgatgtaagtgtgccaaatgtgatcgaagtcatgggagga
gacattggagccttgtgggcatctatccaaaagacatatactcagaatctcatcgatcat
tatcaaatgggatttcgcatcaccagaggccttttcgaggactccaatttccaggatttt
ctgaagagcaaccaaagctttgatgcgatcatatgtgagactttctacaatgatgcccac
tatggcttggcagagcattttaatgctccactgattggattggccaccggtggaggtctg
acatttatcacagatatggttggttcccccgctccagcttcgttcgtgccccacataatg
ctaccctttaacgatcacatgtcgctgtacgaacgccttttgaacgtggcttttcttggc
tatgaaagagttctactggactactatttcttaccgactcaggagaagttatacaaggag
ttctttccgggcaacaagaggtgtttctataagatgcgccgaaatgcctccttggtgctc
atcaatcaacatgtttcactaagttttccgcgaccgcactcacccaacatgattgaagtg
ggtggcatgcatatcgacggaaagtggaatccactgcccgagaagatcgagagattcatc
aatgagtcagaacatggagccatttacttttccatgggatcgaatctcaagaccaaggac
ttacccccatcaaaggttcaagagatcctgaaagcattaggtgggctcaaacagcgtgtt
ctctggaaatttgagctggataacctgcccaacaaaccggagaatgtctacatttccgac
tggtttccacagacggacatattggcccatcccaagatcatggcatttgtgacccacggc
ggcatgctgagcaccacggagtccatttatcatgctaaacccgtgatcggtttgccgatc
tttagtgatcagtttttcaacatggctcatgccgagcaaaacggctatggcataatgctg
gacttcaagacgctgaatgccgtagaattccggaaagcaatcgagcggattacaagtgag
ccatcctacaccaaagtggtgcagggcatatccttccgatatcgggatcaacaacaaacg
ccaattgaaaatgcgatatactgggtggaacatgtgacccgccatcaaggagctgcctat
ttgaaaagtgcggcacaaaggctgaactggtggcagtaccacaatgttgatgtgctccta
attatttttgtagtaatggttctgttgctaattgtactgccaattactatctataagctg
cttaaaaagttattactcaaaggagagagaactcaaagcactaaagtcaaacgcaactag

DBGET integrated database retrieval system