KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6663
Entry
Dmel_CG6663       CDS       T00030                                 

Gene name
Spn77Bb
Definition
(RefSeq) serpin 77Bb
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 40235
NCBI-ProteinID: NP_649206
FlyBase: FBgn0036969
UniProt: Q9VWB4
Position
3L
AA seq 362 aa
MKLGFLGLFGMVLMIMFYEGAEGYTVNELRDVLGIYVDYPTLRRWYEDVRAYHYLNSENT
KLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREGRPRGVDFDQGASIIINDDID
KASHAKIFSSYSRRSFNSTVTVLGITVSYFKAKWKYPFDKSQTKVEQFYNDGGSPAGKVE
MMVQTGKYAYVNNVKGLQADVLELPFGEHELVMIVLLPKSSQGVNLVLYQLKNLGLHRLL
EKLEASKNETDVEVKLPKFDTRSVLSLEDTVYDAGLTDLRNDFADLDKLLIAIGHRGACL
TLYHQFARIVVDEEGLPNAVPQKSSGKNNIKFHVNRPFAYLVLQKKHKLLIHSGVFREGE
IQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgaagctcggatttctggggctttttggcatggtgctcatgatcatgttctacgaggga
gcagaagggtataccgtcaatgagctgcgcgatgtcctggggatctatgtcgattatcca
acactgcgcaggtggtacgaggatgtccgagcttatcactatttaaattcggaaaacaca
aaactgttttcgctgcgttacgcttactacgacgacgtaggagatttagaactcgtgaaa
gggtacaacagtgtagtcctagaaggagtaggagaaggaaatgtggttcttcgagagggt
cggccaaggggtgtggacttcgaccagggggcgagtataataatcaacgacgatatcgac
aaagcctctcatgcgaaaatcttcagttcttatagccgtcgttcgttcaatagtacagta
actgtgctggggattactgttagctactttaaggccaaatggaagtatccattcgataag
tcccagacgaaagtggaacagttttacaacgacggcggctcgccggcaggtaaggtggag
atgatggtgcaaacggggaagtatgcctacgtcaataatgtaaagggtctgcaagcggat
gtcctggagctaccttttggggaacatgagctagtaatgatcgtcttactgccgaagtca
tcccagggagttaacctggtgctctaccaattgaagaacctgggactacatcgcctcctt
gagaaactcgaggcctccaagaatgaaactgatgtagaagtcaagcttcccaagttcgat
acgcgatccgtactttcactcgaagataccgtatatgacgctggactaacggatctgagg
aacgacttcgcagatctagataaattgctgattgctatcggtcacagaggtgcgtgcctc
accctctaccaccaattcgccaggatcgtcgtagatgaagagggtttgcctaatgctgtt
ccgcagaagtcttctggaaaaaataacatcaagttccatgtaaacaggccgtttgcatac
cttgtcctacaaaagaaacacaaattgctcattcactccggagtctttcgggaaggtgag
atccagtaa

DBGET integrated database retrieval system