KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6667Help
Entry
Dmel_CG6667       CDS       T00030                                 

Gene name
dl
Definition
(RefSeq) dorsal, isoform F
  KO
K09254  c-Rel proto-oncogene protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG6667 (dl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG6667 (dl)
Transcription factors [BR:dme03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    Dmel_CG6667 (dl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 35047
NCBI-ProteinID: NP_001286014
FlyBase: FBgn0260632
UniProt: P15330 C7LA93
Position
2L
AA seq 999 aa AA seqDB search
MFPNQNNGAAPGQGPAVDGQQSLNYNGLPAQQQQQLAQSTKNVRKKPYVKITEQPAGKAL
RFRYECEGRSAGSIPGVNSTPENKTYPTIEIVGYKGRAVVVVSCVTKDTPYRPHPHNLVG
KEGCKKGVCTLEINSETMRAVFSNLGIQCVKKKDIEAALKAREEIRVDPFKTGFSHRFQP
SSIDLNSVRLCFQVFMESEQKGRFTSPLPPVVSEPIFDKKAMSDLVICRLCSCSATVFGN
TQIILLCEKVAKEDISVRFFEEKNGQSVWEAFGDFQHTDVHKQTAITFKTPRYHTLDITE
PAKVFIQLRRPSDGVTSEALPFEYVPMDSGKHTFWNLHRHLKRKPDEDLFQQILRLDAKR
EVQPPTIEVIDLDTPKIDVQREIPSEMEFNHEESQQSEPALEQEQSVQQEQYTQEQSLQQ
EQYTQEQSLQQEQYLQQLEQQQSFQLEEPMQQDQELPAQQSFDQAIDHLPDHTSDHIPED
MEAADAHAEAEAHRLRSEQEKEIDTIIDEKVRELEQLDLGQQLEPRPLTANDKITEWMKS
SEIEQQVHEPSPTAEADVLDSALEISKADKTLDELLETVAELDEIYTDFKVQRDTYKNTI
QNELAGLQGRAPLQVEDSFDDAATYTSLQIAFKNPVLIPMDDIMPPTPPMSQCAPEDAHQ
HYDPVEVNSQARKPETPMRPVPPVPPAILTIQYPPEEDKLPPLPPKRIRKQDSNAENRSI
EANTVQTKPSTGESPLNKRLPPAPKNPNFNTLPRQKKPGFFSKLFSRRKSKPDLAQGQEN
SSILDSKANSREPSIGHFNMQDPMRASLRSSKSAAPFISNPAPAKSSPVKAKKPGSKLTK
PVGRSVSSVSGKRPAYLNADVVHIPLKGDSVNSLPQQQRTEGYSQSSTISVGAGLDRRTA
SALQLADIPISEGGMELVAIADRQSLHNLVSSIEGHFNVQLDPNLDLTEAEHFALYTSIP
PLAAASEFDETSAYYAPVDAGEILTPDEVAKRLAAANGI
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgaaccagaacaatggagccgctcctgggcagggtccagcagttgatggccaa
cagagcctcaactacaacggcctgcccgcccagcagcagcagcaattggcacagtccacg
aaaaatgtgcgaaagaagccctacgtaaagatcaccgaacaaccggcaggaaaggcgcta
aggtttcgctacgagtgcgagggacgctcggcgggatccattccgggcgtgaactctacg
ccggagaacaagacctatccgacaatcgaaattgtgggctacaagggacgcgccgtagtt
gttgtctcctgcgtcacaaaggatacgccatatcgtcctcatccccacaatttagttggc
aaggagggctgcaagaagggcgtctgtacactggagatcaacagtgagacaatgcgagcg
gtgttcagtaacttgggtatccagtgtgtcaaaaagaaggacattgaggcggcgctcaag
gcgcgcgaggagatccgtgtggatccgtttaagactggcttttcgcatcgtttccagccc
tcgagcatagatctgaattcggtgcgattgtgctttcaagtattcatggagagcgagcag
aagggtcgattcacctcgccactgccgccggtagtttcggagcccatcttcgataagaag
gccatgtccgacctggtcatctgccggctgtgtagctgctcggccaccgttttcggcaac
acccagatcatcctgctctgcgagaaggtggccaaggaggacatctccgtgcgattcttt
gaggagaagaatggccagagtgtttgggaggcctttggtgacttccagcacacggatgtc
cacaagcagactgccattacctttaagacgccgcgctatcataccctggacatcacagag
cccgccaaggtttttattcaactgcgacgtccctcggatggagttaccagcgaggccctg
cccttcgagtacgtgccaatggactcaggtaaacatacattctggaatcttcatcggcac
ctcaagcggaagccggacgaagatctctttcagcagatcctcaggttggacgccaaacgg
gaagtgcagccgccaacgattgaggttatcgatttggatacaccgaaaatagatgtgcaa
cgtgagataccttcggaaatggaatttaatcatgaggaatctcagcaatcagagccagct
cttgagcaagagcagtcagtgcaacaggagcaatatactcaagagcaatcattgcaacaa
gagcaatatacacaagagcaatcattacagcaggaacaatatttacaacaactagaacag
cagcaatcttttcagctcgaagaaccgatgcaacaggatcaggaactaccagcgcagcaa
tcgttcgatcaggctatagatcacttgcccgatcacacctcagatcatattcccgaggac
atggaggcggcggatgcccatgcagaagccgaggcccatcgcctgcgatccgagcaggaa
aaagagattgacaccattatcgatgaaaaggtacgagaactggagcaactggatttgggt
cagcagttggagccacgtcctttgacggccaacgataagatcaccgagtggatgaagtcc
agtgagattgaacagcaagtccatgagcccagtcccactgctgaggcagatgttttggac
tccgcccttgagatatccaaggcagataagacccttgacgaactccttgagaccgtggcc
gaactggatgagatatacacggacttcaaagttcagagggatacgtacaagaataccata
caaaatgagttggcgggacttcagggtcgtgcgccgctgcaggtggaggatagcttcgat
gacgctgccacctacacaagcttacagattgccttcaagaatcccgtcctcatacccatg
gatgatataatgcctccaactccgcccatgtcgcaatgcgctcccgaagatgcccatcag
cattacgatcccgtcgaggtgaactctcaggcccgcaagccggagactccgatgcgacca
gttcctccagtcccgccggcaattctaacaattcaatatccaccagaagaggataagttg
cccccattgccaccgaaaagaattcgaaagcaggacagcaatgctgagaatcgatcaatc
gaggccaatacggttcagaccaagccatctacaggcgagtctcctctaaacaaaagactc
ccacctgctccaaagaacccgaactttaatacactgcccaggcagaagaagccgggattc
ttttcgaagcttttttcgcgccgcaagagcaaaccagatttggcccaggggcaggagaac
agctctatattggattccaaggcaaatagcagggagccaagtataggtcactttaacatg
caagacccgatgagggcatcgctgcgctcctccaagtcagctgccccgttcatctcgaat
ccagcgcctgccaaatccagtcctgtcaaggccaagaaaccaggatcaaagctgaccaag
cccgtgggcaggagtgtgagcagtgtttccggaaagagacccgcctacctgaatgctgat
gtggtgcatataccgctgaaaggtgacagtgtcaatagtttgccacagcaacagcgaacc
gagggctactcccaatccagtacgatttcggtgggagctgggttggatagacgcactgca
tctgcactacagctggctgacataccaattagtgagggcggaatggaactggttgccatt
gccgatcgacaaagtctacacaatttggtcagctccatagagggtcacttcaatgtccaa
ctggaccccaatttggatctgaccgaggccgagcactttgccctgtacacgagtattccg
ccacttgcggcggccagtgaatttgacgagacctccgcctactatgctcccgtggatgct
ggcgagattttaacgccggatgaggtggccaagcgattggctgcggcaaatggcatctag

DBGET integrated database retrieval system