KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6708Help
Entry
Dmel_CG6708       CDS       T00030                                 

Gene name
Osbp
Definition
(RefSeq) oxysterol binding protein
  KO
K20456  oxysterol-binding protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG6708 (Osbp)
Membrane trafficking [BR:dme04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    Dmel_CG6708 (Osbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxysterol_BP PH PH_8 PH_11 DUF5301
Motif
Other DBs
NCBI-GeneID: 42985
NCBI-ProteinID: NP_477271
FlyBase: FBgn0020626
UniProt: Q9VC05
Position
3R
AA seq 784 aa AA seqDB search
MTDAAGNALAEKGLPEMKGWLLKWTNYIKGYQRRWFVLSKGVLSYYRNQSEINHTCRGTI
SLHGALIHTVDSCTFVISNGGTQTFHIKAGTEVERQSWVTALELAKAKAIRAIECEEEEE
TETAHVVPSQEISSVVRDLTDRLESMRTCYDLITKHGAALQRALNDLETNEEESLGSRTK
IVNERATLFRITSNAMINAGNDYLHTAEAQGHKWSKMLHHEREQRQRLEEIIEQMAKQQS
QMEQAAVLVRQNKPVSSTSGAGTAGSLVTSDEEMEFFDAEEHGYSGSGRSPESSDCERGT
FILKMHKRRSSSEDQVEGHLEGSSSESDEQKRTVQTVQQVCLVSAPRVASGGQGDDDDDV
DKALPAKESTDSIYGRNWNPDLIKKRRDRVPDKPNHPISLWGIMKNCIGKDLSKIPMPIN
FNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIAAFTVSAYATTTNRTGKPFNPLL
GETYECDRMDDYGWRCLAEQVSHHPPVAALHCESKNWTCWQEFSMTSKFRGKYVQINPLG
GVYVQFPNSGRRYSWRKVTTTVNNIIVGKLWVDQHGEMEIRGSQAAEGHKCILNFIPYSY
FSRDVQRSVKGVVMNKDNEVKWVVRGTWDMKIEIAPVLKTSGSVSSPTYTTGEFKLAWRR
RPAPPDSDKFYNFTTLACQLNEEEEGVAPTDSRLRPDQRLMEQGDWDESNKEKLRLEEKQ
RTERRRRENEAEEAAAEGRPYPAYEPMWFKREKEEGSEEYVHVFKNTYWEAKAAQNFEGC
PDIY
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgccgctggcaatgcgctggccgagaagggcctaccggagatgaaaggctgg
ctgctaaagtggaccaattacatcaagggctaccagcggcgatggttcgtgctatccaag
ggcgtgctgagctactaccgcaaccagtcggagattaaccacacgtgccggggcaccata
tcgcttcacggagccctcatccacacggtcgattcgtgcacgttcgtaatctcgaacggc
ggcacccaaacgttccacatcaaggccggcaccgaggtggagcgccagtcgtgggtcacc
gccctggagctggcaaaggctaaggcaatccgggccatcgaatgcgaggaggaggaggag
acggaaacggcacatgtggtgcccagccaggagatcagctcggtggtccgagatctcacc
gatcggctggagagcatgcgtacctgctacgacctgatcaccaagcatggcgcagccttg
cagcgcgctctcaacgatctggagacgaacgaggaggagtcgctgggcagccgcacgaag
atcgtcaacgagagggcgaccctcttccggataacctccaatgcgatgatcaacgccggc
aacgactacctgcacacggcagaggcacaaggccataagtggtccaagatgctacaccac
gagcgcgagcaacgccagcggctggaggagatcatcgagcagatggcaaagcagcagtcg
cagatggagcaggccgccgtactggtgcgccagaacaagccggtgtcatccacctcgggg
gcaggcaccgccggctccttggtgacctcagatgaggagatggagtttttcgatgccgag
gagcacggctattcaggcagcggtcgctcccctgagtcttcggattgcgagcggggtacc
tttatcttaaagatgcacaagcgccgcagtagtagcgaggaccaggtggagggccatttg
gagggcagttcctcggagagtgacgagcagaagcgcaccgtgcaaacggtgcagcaggtg
tgcctggtgagtgcgccacgggtagcatcgggcggtcagggcgacgacgatgacgacgtg
gataaggcgttgccggccaaggagagcaccgactccatctacggacgcaactggaatccg
gatctgattaagaagcgacgcgaccgtgtgccagataaaccgaaccaccccatcagcctg
tggggcatcatgaaaaattgcattggcaaggatctgtccaaaattcccatgcccatcaac
tttaacgaaccgctgtccatgctgcagcgcctggtggaggactatgagtacacggagata
ctcgactacgcggccacctgccaggacgagtgcgagcagctggcctacatagccgccttt
accgtgtccgcctatgccacgaccacaaaccgcacaggcaagcccttcaatccgctgctg
ggcgagacctacgagtgtgaccggatggatgactatggttggcggtgcctggccgagcaa
gtgtcccatcatccaccggtggcggcgctgcactgcgaaagtaagaactggacgtgctgg
caggagttctccatgaccagcaagttccgcggcaagtacgttcaaatcaatcccttgggc
ggcgtctatgtgcaattcccgaacagcggcaggcgctattcctggcgcaaggtgaccaca
acggtgaacaacatcattgtgggcaaactgtgggtggaccagcatggcgaaatggaaatc
cggggatcgcaggcggcagaggggcacaaatgcatcctgaactttatcccctactcgtac
tttagtcgcgatgtgcagcgaagcgtcaaaggcgtggtaatgaacaaagacaacgaggtc
aagtgggtggtgcgtggtacgtgggacatgaagatcgagattgcaccggtgctcaagaca
tcgggatcggtcagcagtccaacgtacaccacgggcgagtttaagctggcctggcgccgt
cgtcctgctcctccggattcggacaagttttataacttcactacactagcctgccagctc
aacgaagaggaggagggcgtggcgccgacggactcacgccttcgtcccgaccaaaggctg
atggagcagggcgactgggacgagtcgaataaggagaaattgcgcctggaggagaagcag
cgcacagaacgccgccggcgggaaaacgaggcggaggaggccgccgcagagggtaggcca
tatccagcctatgagcccatgtggttcaagcgcgaaaaggaggagggaagcgaggaatat
gtgcacgttttcaagaacacttactgggaggccaaggcggctcagaacttcgaaggctgt
ccggacatatactag

DBGET integrated database retrieval system