KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6717
Entry
Dmel_CG6717       CDS       T00030                                 

Gene name
Spn28B
Definition
(RefSeq) serpin 28B, isoform B
  KO
K13963  serpin B
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG6717 (Spn28B)
Peptidases and inhibitors [BR:dme01002]
 Peptidase inhibitors
  Family I4: serpin family
   Dmel_CG6717 (Spn28B)
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 34035
NCBI-ProteinID: NP_001260209
FlyBase: FBgn0083141
UniProt: Q9VLZ8
Position
2L
AA seq 378 aa
MKYLYLLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEEL
RNVLKFSENKTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFK
AKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYN
FKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPN
SVDGLRKLKEKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNG
LVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYV
IHDNKVIYFQGHIVEPRW
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgaaatacttgtatcttcttttgttggccacctcagtagagagcgggttttgggaggac
ttttatcgaattctagcatcgcagaatgcaaaaaggaacctcatttattcgccgatatct
gctgagattattatgagcatggtttatatggcatcaggtggaaaaacgttcgaagagctt
agaaacgttttgaaattttctgagaacaaaacacttgtggcaaacaactatcgtagcctt
ttaagcgatcttaagcgccgcgaaacgtttattatcctgcatatggcaaaccggatatat
gtgaacaagaaatattgccttgtaccggaatttaaccagttggcacgaaaggccttcaag
gccaaagccaagtcgatccgtctagacgatccagtcagtgcgtctgcgatagtcaatagc
tggatattaaatcgaacgcgtggcatgatccggaacatagttttacctaaggactttaat
tcggatacaagtgcgtttctggtgaatgcaatctacttcaagggccagtggctgtataac
ttcaaggccgaccaaactcatatagccgacttctatgtatcagctaacgaaattattccg
gtgaagatgatgactttgtctgcatccctactatcaggatacatcgatgacattgatgca
aagattatcgaactaccctactggaactcaactctttctatgcgcatcattctgcccaat
agtgttgatggtcttagaaaactgaaagagaaagttggttttattgactatcatttggaa
aaaaaatccgtaaatgttaaactgcccaagttcaaaatcgaatctaaagcacaactaaag
ggaatttttgaaaatttaggcattctagatgtatttaagccctcagctgacttaaatggg
ctcgtcctagaatctggtgctaagatcgataaaattgtgcaaaaggcctttctgaagatc
gatgaaaagggtggcgaagcttctgcggcaacaggtgttcttactcgccgaaagaagtcc
attgacaatttaatacagcctccaatggagtttatagctgatcatccgtttttctacgta
attcatgacaacaaagtcatttactttcagggtcacatcgttgaaccacgctggtaa

DBGET integrated database retrieval system