KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6754
Entry
Dmel_CG6754       CDS       T00030                                 

Symbol
nbs
Name
(RefSeq) nbs, isoform D
  KO
K10867  nibrin
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Dmel_CG6754 (nbs)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dme03032]
    Dmel_CG6754 (nbs)
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG6754 (nbs)
DNA replication proteins [BR:dme03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    Dmel_CG6754 (nbs)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     Dmel_CG6754 (nbs)
    BRCA1-C complex
     Dmel_CG6754 (nbs)
SSDB
Motif
Pfam: NIBRIN_BRCT_II FHA BRCT PTCB-BRCT RTT107_BRCT_5 Yop-YscD_cpl
Other DBs
NCBI-GeneID: 44259
NCBI-ProteinID: NP_001246702
FlyBase: FBgn0261530
UniProt: M9NF67
Position
3L:complement(9720414..9723194)
AA seq 816 aa
MFVLTKDDEKFVLFPGKKVYTIGRLATDLIVAQDLSISRNHAQLLIQTEADGDDTLHIED
LGSRYGTFIFPKNSQKPRKVPAKTSTPLPVGTRLRFGANMSIWQVTQLKLVTTVSALTRS
EVQELTKMLEPMGGTVTSNWTEECSHLTMNEVSVTVKLLHAMLENKPIVTFPYWRKMLQA
AQSIHVKEGWPQPEDYQPTNIDVTWRPERTRLFAGKTFVFMNRKHFDMYGSVVQKAGATC
KDINSGVRKTFLTKSDVIVIQYVPSSQSQATESINSIQDILEQNGRRIIQEYEIGMALIH
CSITEFCNPTHKFISDSLPTTESVTSSMAFNSSIIVPNTERHSAQSNATPISELVVPESI
ECEMEQDASKPHSEDQASLRKRSHASTVDSSDEEKKSTLSKRAKSDIATKLTMKSKNAIL
LDSSLEEDVTPAPAPAPVQRVTRQSKAIAEEKSVHPPVPAASKHITRKTKQVFCVDSSDE
ENENARKPKETPAPTIPSMAKKKTEAPVATRISPRLNGKSLATNITNQPADKHAVPAKRP
VLSVASSDEEDEGDLFQFRKSPQKPAETVVQPRIAGKGNAPARISVVDFLEKSQAQEPAP
VPPQLESQSQTQPRKRLRLELLNESDSDDCDNLFNFADSKKKRKTQEAQRNDDSTDGLFN
FNSERPSDHDDEDSRLTEPFVPETESKKQSKYIVAPRRDRPKKVDISGWLSCSRLNDNIK
SEIDADSVKMETSIKADPDEEQWLAAMKDSIEVRMCNLNIVIRSQEEVDASLEDSVNKHG
GRKNFKKFVKTKNPHPQKRIVALKSLRLADGMVTCV
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgtttgttttgactaaagatgacgaaaagtttgtgttgtttcctggcaaaaaggtgtac
accattggtcgcctggccacggatttaattgttgcgcaggacctcagtataagtcgcaat
catgcccagctgctcatccaaacggaagcggatggcgatgacaccctgcatatcgaggac
cttggctccagatatggcactttcattttccccaagaattcccaaaagccgcgcaaggtg
cctgccaaaacatcgactccattgcctgtgggcacacgcttgcgatttggcgcaaacatg
agcatttggcaggtgacccaactgaagttggttacaactgtctccgcattaacgcgttcc
gaggtccaggagctcacgaagatgcttgaacccatgggcggcacggtcacttcgaactgg
accgaagagtgctcccatctaaccatgaacgaagtttcggtgaccgtgaaactactgcac
gctatgctcgagaataagccgattgtgacattcccctactggcgaaagatgctgcaggca
gcgcagagcatccatgtcaaggagggctggcctcagccggaggattaccagcccaccaac
atagatgtcacctggcgtcctgagcgtacccgtctcttcgccggcaagacattcgtcttc
atgaaccgcaaacactttgatatgtacggatcagttgtgcagaaggctggagccacgtgc
aaggacatcaattcgggtgtgcgcaaaacattcctaacaaagagtgatgtgatagtcata
cagtatgtgccatcgtcccagtcgcaggccactgaatcaatcaatagtatacaagatatt
ttggaacagaatggtcgacgtattatccaggagtacgagattggcatggccctaatacat
tgctctataacagaattctgcaacccaacgcacaagttcatctccgattcattgcccacc
acggagtctgtaacttcctcgatggcctttaactcttcgatcattgtgcccaacacggaa
cgccactcggcgcaatccaatgccacgcccatttccgaactggtggtgcctgagtcaatt
gaatgtgaaatggaacaagatgcttctaagccccattcggaggaccaagcttctttgcgt
aagcggagtcatgcctcaacagttgactcctcggacgaggagaagaaatcaacattgtct
aagcgagctaaatcggatatcgctacgaaactgaccatgaaatcaaagaatgccatattg
ttggactcgtctttggaagaagatgtgacaccagctccggcgcctgctccagttcaacga
gtaacaaggcagagcaaagccatcgctgaggagaaatccgtacatccacctgttccagct
gcgagtaagcacataacacggaagaccaaacaggttttttgtgttgactcatcggatgag
gagaacgaaaatgctcggaaaccaaaagaaacgccagctccaactatcccttcgatggcc
aagaagaaaacggaagcacccgttgccaccaggatttcaccacgactcaatgggaaatca
ttggccacaaatattaccaaccaaccggctgacaaacatgcagtgcctgcaaaacgtcct
gttttatcggtggcctcgagtgacgaagaagatgaaggggacctatttcaattccgtaaa
tctccacagaagccagcagagactgtggttcagccaagaatcgcaggcaaaggcaatgca
cctgccagaatcagtgtagtcgactttctagagaaatcacaggcacaagaaccagctcca
gtgccaccccaattggagtcccaatcccagacacaaccgcgcaagcgtttacgccttgag
ctgctaaacgaaagcgacagcgatgattgtgataatctttttaactttgcagacagcaaa
aagaaacgaaagacgcaagaggctcagagaaatgatgactccacggatggcttgtttaac
ttcaactctgaaagaccgtctgatcatgatgacgaggattcccggttaaccgaaccattt
gtacccgaaacggaaagcaagaagcaatccaagtacatagtggcaccgcgtagagataga
cccaagaaagtggacatcagtggttggttatcgtgtagcaggctaaacgataatatcaaa
tccgaaatagatgcagactcagttaagatggaaacctctattaaggcggatcccgatgag
gagcaatggctggccgccatgaaagacagcattgaggtgcgcatgtgcaacttaaacatt
gtcattcgctcccaggaggaagtggatgcttctcttgaggattctgtgaacaagcatggc
ggccgcaagaactttaagaagtttgtaaagaccaaaaatcctcatccccaaaagcgaatt
gttgcgcttaagagtcttcggctggctgatggtatggtaacctgtgtttaa

DBGET integrated database retrieval system