KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6782
Entry
Dmel_CG6782       CDS       T00030                                 

Gene name
sea
Definition
(RefSeq) scheggia, isoform E
  KO
K15100  solute carrier family 25 (mitochondrial citrate transporter), member 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG6782 (sea)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   Dmel_CG6782 (sea)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 3772221
NCBI-ProteinID: NP_001027175
FlyBase: FBgn0037912
UniProt: Q7KSQ0
Position
3R
AA seq 317 aa
MDRSAFASLVSPYRRRPWMTEHGAAAADSGQVGLKGIVAGGITGGIEICITYPTEYVKTQ
LQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNA
VDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFINDQRSGNPKFRGFAHGVGQII
KSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGA
ASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAI
TFMIYDSFMDLFNKVWV
NT seq 954 nt   +upstreamnt  +downstreamnt
atggatcgctccgccttcgcgtcccttgtcagcccgtaccgccgacgtccgtggatgacg
gagcacggagcggcggctgcggacagcggccaggtgggccttaagggcatcgtcgccggc
ggtattacgggcggcatcgagatctgcatcacctatcccaccgagtatgtgaagacacaa
ctgcagctggacgagaagggagcggcgaagaagtacaacggcatctttgattgcgttaag
aagacggtgggagaacgtggattcctgggtctctaccgaggtctcagtgtgctcgtctac
ggcagcattcctaagtcagcggcgagattcggtgcttttgaattcctgaaatcgaacgcc
gtggactcccgaggacaactgagcaactccggaaagttgctttgcggcttaggagctggc
gtatgtgaggccatcgtggcagtgaccccgatggagaccatcaaggtgaagttcatcaac
gatcagcgcagcggcaatcccaagttcaggggattcgcccacggcgttggccaaatcatc
aagtcggagggcatctctggtatctacaagggcctaacgcccaccattctgaaacagggc
tccaaccaggccattcgcttcttcgtactggagtcccttaaggatttgtacaagggtgac
gatcacacgaagccagtgcccaagttggtggttggagtgtttggagctatcgccggagca
gcctctgtgttcggtaatacgccgctggatgtggtcaagacgaggatgcagggtctggaa
gcatcgaaatacaagaacactgcccactgtgcggtggagatcttgaagaacgaaggtccc
gccgccttctacaagggcaccgtgccaagattaggtcgtgtgtgcctggatgtggccatc
acctttatgatctacgactccttcatggatctgttcaacaaggtgtgggtgtaa

DBGET integrated database retrieval system