KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6783
Entry
Dmel_CG6783       CDS       T00030                                 

Gene name
fabp
Definition
(RefSeq) fatty acid binding protein, isoform C
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG6783 (fabp)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Dmel_CG6783 (fabp)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 3772232
NCBI-ProteinID: NP_001027179
FlyBase: FBgn0037913
UniProt: Q8INK3
Structure
PDB: 
5GGE 5GKB

Position
3R
AA seq 157 aa
MSFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTS
AISFKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGDKPTTIVREFTDNELITLIPHLT
PSQHGSLRLRVPCQPVPPTSVDDGARSGGCGQRPGGP
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtctttcgttggcaagaagtacaagctggacaagtccgagaacttcgatgagtacatg
aaggagctgggcgtcggtctggtgacgcgcaagatgggcaacagcctgagccccacagtg
gaggtgaccttggagggcgatacctacaccctgactaccacctccaccttcaagacctct
gccatcagcttcaagctgggcgttgagttcgacgaggagaccctggacggtcgcaacgtc
aagagcatcatcaccctggatggcaacaagctgacgcaggagcagaagggcgacaagccc
accaccatcgtccgcgagttcaccgacaacgagctgatcaccctaattccccacctaaca
cccagtcagcatggatcgctccgccttcgcgtcccttgtcagcccgtaccgccgacgtcc
gtggatgacggagcacggagcggcggctgcggacagcggccaggtgggccttaa

DBGET integrated database retrieval system