KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6794
Entry
Dmel_CG6794       CDS       T00030                                 

Symbol
Dif
Name
(RefSeq) Dorsal-related immunity factor, isoform D
  KO
K09254  c-Rel proto-oncogene protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG6794 (Dif)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG6794 (Dif)
Transcription factors [BR:dme03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    Dmel_CG6794 (Dif)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 35045
NCBI-ProteinID: NP_001162999
FlyBase: FBgn0011274
UniProt: P98149 E1JHK1
Position
2L
AA seq 667 aa
MFEEAFGDIQEIINASMELNGGATGGGSVAGAVGGGGAAHHILSQSTSLPVMPSHIPLHL
QNQNMNQNLPEPSARSGPHLRIVEEPTSNIIRFRYKCEGRTAGSIPGMNSSSETGKTFPT
IEVCNYDGPVIIVVSCVTSDEPFRQHPHWLVSKEEADACKSGIYQKKLPPEERRLVLQKV
GIQCAKKLEMRDSLVERERRNIDPFNAKFDHKDQIDKINRYELRLCYQAFITVGNSKVPL
DPIVSSPIYGKSSELTITRLCSCAATANGGDEIIMLCEKIAKDDIEVRFYETDKDGRETW
FANAEFQPTDVFKQMAIAFKTPRYRNTEITQSVNVELKLVRPSDGATSAPLPFEYYPNPE
LLTKHNRRVAQKTVESLKRSLMSTNLHPSKQVKTSSQYTIFSKPQIATTTPQTQVSPGMP
LMFPGGSPNFVQDIKMENGFMDVDSQSSQCPSVERNFASPRSNCSTVDSIPPMQMGQNQT
HLYLPDATNFTFNGNFASPSSNCSTVDSIPPFQIGQRNNHMYLPENSNFPVNGCSPTHFS
GGSMTPINNNNNVLINNNNNDFLSQKMSAISIPPQGNFGIKQVYQQTQQFLPQLQPESIP
YLAQSHPEQSQYQQQQQPQEQQPPADEPTQSFSDLISSSIGMAPIDTSELIQDIEAELNS
LGIQPFK
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgtttgaggaggctttcggcgatatacaggaaattatcaatgccagcatggagttgaat
ggtggcgccaccggcggaggcagtgtggcaggagctgttggcggaggcggtgctgcacat
cacatattatcgcagtcgacttccctgccggtaatgccgtcgcacattccgctccacctg
cagaatcagaatatgaatcagaatctgcccgagccaagtgcaagaagtggtccccacctg
cgtatcgtggaggagccgacaagcaatataatccgctttcgctacaaatgcgagggtcgc
accgccggttcgattccgggcatgaactccagctcggaaacgggcaagacctttcccacc
atcgaagtgtgcaactacgatggacccgtcatcatcgtggtctcctgtgtgacgagcgac
gagcccttccgccagcatccccactggctggtcagcaaggaggaggcggatgcctgcaag
tcgggcatctaccaaaagaaattgccgccagaggagcggcggctggtgctccaaaaagtg
ggcatacagtgcgccaagaagctggagatgcgcgactcgctggtggagagggaaaggaga
aacatcgatcccttcaatgccaaattcgatcacaaggaccagatcgacaagatcaatcgg
tatgagttgcgcctctgctaccaggccttcatcacagtgggcaactcaaaagtgcccctg
gatcccatcgtatcctcaccgatttacggcaagagcagcgaactgaccatcacccggctg
tgcagttgcgcggccactgcgaacggcggcgacgagatcatcatgctgtgcgagaagatt
gccaaggacgacatcgaggtgcgattctatgagacggacaaggatggacgggagacgtgg
ttcgccaacgcagagttccaacccacggacgtgttcaaacagatggccatagcttttaag
acgccgcgctacaggaacaccgagatcacacaaagtgttaatgtggagctgaaactagtg
agaccctcggatggagcgacgagtgccccactgccgttcgagtactacccgaatccagaa
ctcctaaccaaacacaatcgccgtgttgcccaaaaaacagttgaaagcctaaagcgcagt
ctcatgagcaccaatttacatccatccaagcaggttaaaacctccagccagtatacgata
ttttccaagccacaaattgcgaccacaacaccgcagacacaggtgtcgcctggtatgcct
ttgatgtttcccggcggaagtcccaattttgtgcaggatatcaagatggagaatggattc
atggatgtggatagccagagtagccagtgtccatcagtggaacgcaatttcgcttcgcct
cgatccaactgcagtacagtggatagtattccgccgatgcaaatggggcaaaatcaaact
catctttatttgccagatgccacaaacttcacatttaatgggaatttcgcatcgccttcg
tccaattgcagtacagtggatagcattccgccgtttcaaatcggacagaggaataaccat
atgtatctgccggagaattcaaactttccggtaaacggctgtagtcctacccatttcagt
ggtggctctatgacaccaatcaataataacaacaatgtactaattaataacaataacaat
gactttttaagtcagaaaatgagtgccataagcataccgccacaaggaaattttggcatt
aaacaggtatatcaacagactcagcagttcctgccgcaattgcagccagagtccattcca
tatctggcccaatcccatccagaacagtcgcagtaccaacagcaacagcagccacaggag
cagcaacctccagcagatgaacccacccaatcgtttagtgatctaatttccagcagcata
ggcatggcgcccattgacaccagcgaacttatccaggacattgaggcagaactcaatagc
ttgggaattcagccattcaaatga

DBGET integrated database retrieval system