KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6835Help
Entry
Dmel_CG6835       CDS       T00030                                 

Gene name
Gss1
Definition
(RefSeq) glutathione synthetase 1, isoform E
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00270  Cysteine and methionine metabolism
dme00480  Glutathione metabolism
dme01100  Metabolic pathways
Module
dme_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dmel_CG6835 (Gss1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG6835 (Gss1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG6835 (Gss1)
Enzymes [BR:dme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Dmel_CG6835 (Gss1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG6835 (Gss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase GAT
Motif
Other DBs
NCBI-GeneID: 32775
NCBI-ProteinID: NP_001162782
FlyBase: FBgn0030882
UniProt: Q8IQZ1
Position
X
AA seq 491 aa AA seqDB search
MSSDANTAVLRNCIRLPLAEDELLEVTAKAKDYAIMHGAAMRSKTAFSPDSLNFAPFVLV
PSSFPRKEFEKAVALQPIINRLMHNVAHDEEFITTTLAETIKVDEFTANLFNIYRKVLAH
GFTQAYSIGLLRSDYMAHVSEGCAIKQVEINTVASSFAGIATQLVPQQKFVLSELGHADK
LHNMPDNNALAGLCDGMVKAWDIYAKPQAVILFIIEDVSYNICDQRFHEFYIRETYPHIK
VLRRTLTEVHREGKLGQSKELLLGSQEVAVIYFRAGYEPGHYHSQADWDARYLMETSLAI
KCPSIHYHLAGTKKVQQALAQPAVLERFINDPEEIKAVGKIFTGLYSLDDNEAGNASYEM
ALRTPERFVLKPQREGGGNNVYGVDIPDALKRMSRVERSAWILMDLIHPPLTKGYMVRPG
GDMPPQIVDMVSELGIFGVVIGDAEHIVHNYQAGHMLRTKLSTANEGGVAAGLGALDSPY
LIDSDDEDEQK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgacgccaatacggccgtgctgcgcaactgcatccgcttgccgctggcggag
gatgagctactggaggtgacggccaaggccaaggattatgccattatgcacggcgccgcc
atgcgatcgaagacggccttcagtccggactcgttgaatttcgcccccttcgtgctggtg
ccttcctcgtttccgcgcaaggagttcgaaaaggcggtggccctacagccgatcatcaac
cggctgatgcacaatgtggcccacgacgaggagttcatcacgacgacgctggcggagacg
atcaaagtggacgagttcacggccaatctgttcaacatctatcgcaaggtgctggcgcac
ggattcacccaggcatatagcatcggtctgttgcgatccgactatatggcacacgtgtcc
gagggctgtgcgataaagcaggtcgagatcaacacggtggcctccagtttcgctggcata
gccacccaattggtgccgcagcagaaattcgtactcagcgagctgggacatgcggataag
ctgcacaatatgccggataacaatgcactggccggactctgcgatggcatggtgaaggcg
tgggacatctatgcaaagccgcaggccgtcattctgttcatcatcgaggatgtgtcgtac
aacatttgcgaccagcggttccacgagttctacattcgcgagacatatccgcacatcaag
gtgctgcgccgcaccctcaccgaggtccatcgggagggcaaactgggccagtccaaggag
ttgctccttggatcccaagaggtggccgtcatctacttccgagctggctacgagcccgga
cactatcactcgcaggcggattgggatgcccgctatctgatggagacctcgctggccatc
aagtgcccgtcgattcactaccatttggcgggcaccaagaaggtgcagcaggcattggcg
cagccggcggtgctcgagcgtttcatcaacgatccggaggagatcaaggcggtgggcaag
atcttcacgggtctctactcgctggacgacaacgaggcgggcaatgccagctacgagatg
gcgctgcgcactccggagagattcgtgctgaagccgcagcgcgagggaggcggcaataat
gtctacggcgtggatataccagatgcactaaagcgcatgtcacgcgtggagcgctccgcc
tggattctgatggatctgattcatccgccgctgaccaagggctatatggtgcggcccggt
ggcgatatgccgccccagatcgtggacatggtctccgagctgggcatcttcggtgtggtg
atcggagatgcggagcacattgtgcacaactaccaggcgggacacatgctgcgcacaaag
ctctcaaccgccaacgaaggaggcgtggcagccggtctgggcgccctggacagtccatat
ctgatcgatagcgatgacgaggatgagcagaagtag

DBGET integrated database retrieval system