KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6944Help
Entry
Dmel_CG6944       CDS       T00030                                 

Gene name
Lam
Definition
(RefSeq) lamin, isoform B
  KO
K07611  lamin B
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG6944 (Lam)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG6944 (Lam)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     Dmel_CG6944 (Lam)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament LTD Spc7 KASH_CCD BLOC1_2 DivIC DUF4407 DUF4600
Motif
Other DBs
NCBI-GeneID: 33782
NCBI-ProteinID: NP_001245892
FlyBase: FBgn0002525
UniProt: P08928 M9NE89
Position
2L
AA seq 622 aa AA seqDB search
MSSKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTHSQTASSPLSPTRHSRVAEKVELQN
LNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTAR
DRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKK
LNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINE
SRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEA
AARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQE
IDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTAT
VQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAKGNVEIKEIDP
EGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASH
EPPSSLVMKSQKWVSADNTRTILLNSEGEAVANLDRIKRIVSQHTSSSRLSRRRSVTAVD
GNEQLYHQQGDPQQSNEKCAIM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaatcccgacgtgctggcaccgccacgccgcagcccggcaacacctccacc
ccccggccgccatcggcgggtccgcagccgccgccgccgtccactcactcgcagacggcc
tccagccccctcagccccacccggcactcgcgcgtggccgagaaggtggagctgcagaac
ctgaacgatcgcctggccacctacattgaccgggtgcgcaacctggagacggagaactcc
cgcctcaccatcgaggtgcagaccaccagggacacggtcacacgcgagaccaccaacatc
aagaacatcttcgaggccgagctgctggagacgcgccgtctgctcgatgacacagctagg
gatcgcgctcgtgccgagatcgatatcaagcgtctctgggaggagaacgaggagctcaag
aacaagctggacaagaagaccaaggagtgcaccactgctgagggcaatgtccgcatgtac
gagtcgcgcgccaacgagctgaacaacaaatacaaccaggccaacgccgatcggaagaag
cttaacgaagacctgaatgaggcgctaaaggagctggagagactgcgtaagcagttcgag
gaaacgcggaagaacctggaacaggagacactgtcgcgcgttgacctggagaacaccatt
cagagtctgcgcgaggagctctcgttcaaggatcagatccattcgcaggagatcaatgag
tcgcgccgcatcaaacagacagagtatagcgagatcgacggtcgcctcagctccgagtac
gatgccaagttgaagcagtcgctgcaggagctgcgcgcccagtacgaggagcagatgcag
attaatcgcgatgaaatccagtccctctacgaggacaagatccaacgactgcaagaggcc
gccgcacgcacatccaattccacgcacaagtccatcgaggagctgcgctccactcgtgtg
cgtatcgatgcgctcaacgccaatatcaacgaactggagcaagccaatgccgacctcaat
gcgcggatccgtgatctggagcgccagctggacaacgatcgcgaacgccacggtcaagag
atagaccttctcgagaaggagctcattcggctgcgcgaagagatgacgcaacagctcaag
gagtaccaggaccttatggacatcaaggtctccctggatttggaaatcgccgcatacgac
aagctgctggtgggcgaggaggctcgtttgaacatcaccccagccaccaacacggccaca
gtgcagtcctttagccagtcgctgcgcaactccacgcgagccacgccatcgcgtcgcact
ccctctgctgccgtgaagcgcaaacgcgccgtggtcgacgagtcggaggatcacagcgtc
gccgattactatgtgtccgccagtgccaagggcaacgtggagatcaaggagatcgatccc
gagggcaagttcgtaaggctgttcaacaagggcagcgaggaggtggccatcggtggctgg
cagctgcagcggctaatcaacgagaaaggtccttcgaccacttacaagttccatcgatcg
gtgaggatcgagccaaatggcgtgatcaccgtttggtcggcggacaccaaggcctcgcac
gagccgccatcgagccttgtgatgaagtcacagaagtgggtctccgccgacaacactagg
acgattttgctgaactccgagggcgaggccgtggccaatctggatcgcatcaagcgcatt
gtgtcccaacacacatcctcctcccggctgagtcgtcgtcgcagcgtgaccgccgtggac
ggcaatgagcagctctaccaccagcagggcgatcctcagcagtcaaacgagaagtgcgcc
attatgtaa

DBGET integrated database retrieval system