KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6946
Entry
Dmel_CG6946       CDS       T00030                                 

Gene name
glo
Definition
(RefSeq) glorund, isoform A
  KO
K12898  heterogeneous nuclear ribonucleoprotein F/H
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dme03041]
    Dmel_CG6946 (glo)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    Dmel_CG6946 (glo)
SSDB
Motif
Pfam: RRM_1 RRM_3
Other DBs
NCBI-GeneID: 41431
NCBI-ProteinID: NP_650120
FlyBase: FBgn0259139
UniProt: Q9VGH5
Structure
PDB: 
5UZG 5UZM 5UZN

Position
3R
AA seq 586 aa
MSNADVQFNYGQQGNGDNFNDDSNQQQDEDDQYNEDGGGKIENVGESPKFVRLRGLPWSA
THKEILDFLENVNVTNGSAGIHLVTSRVDGKNTGEAYVEVASQEDVEEARKLNKASMGHR
YIEVFTATPKEAKEAMRKISGHGTAFVVKLRGLPYAVTEQQIEEFFSGLDIKTDREGILF
VMDRRGRATGEAFVQFESQDDTEQALGRNREKIGHRYIEIFRSSIAEMKRATGAGGGVGG
RPGPYDIRDRGANRGGNDFGGGRNDWGNNGNFGVGANNMLGFNNLPSLMNSGNFGNNQGG
NNGNFGNNSGPSNFGNFGGGNNGGNSGNFGNDSGNSGNFGNFGNNGGGNFGGNNNGGGGF
NSGNNFNSPGGVNNFGNNGGSNFGGNGGGGFNNGGNFVSSSGVGNFGPIGGGRNNNNGNF
GNSGFGNFGGNNNVGSNFGGGNNGGGGGFNNGSNFGGGNSMGGGGNFGPIGGGRGNDIEY
YTIHMRGLPYTSFENDVFKFFEPIRPANVRINYNKKGLHSGTADAYFDTYEDSQVAMKRH
REQMGSRYIELFYDGKTRGLNGGEHGGGNGGGGMGNNGGGNFSRRI
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgtccaacgcagacgtgcaatttaactacggccagcagggaaatggcgacaacttcaac
gacgacagcaaccagcagcaggatgaggatgaccagtacaacgaagatggcggcggcaag
atcgaaaacgtcggcgagagccccaaattcgttcggttgcgcggcctgccctggtccgca
acgcacaaggagatactcgactttctggaaaacgtgaatgtgactaatggctcggcgggc
attcacctggtcaccagtcgggtcgacggcaagaacaccggcgaggcgtacgtggaggtg
gccagccaggaggacgtcgaagaggctcgcaagctgaacaaggccagcatgggtcaccgc
tacattgaagtttttaccgccacgcccaaggaggccaaggaagccatgcggaagatcagc
ggacacggcacggccttcgttgtgaagcttcgtggtctgccatatgccgtcactgagcag
caaatcgaggagttcttctctgggttggatatcaaaacggatcgggagggcatacttttt
gttatggacagaaggggtcgtgcaactggggaagcttttgttcagttcgaaagccaggac
gacactgagcaagccttgggccgaaatcgggaaaaaattgggcacaggtatattgagata
ttccgcagctcgattgctgaaatgaagagggccacaggcgccggtggcggtgtcggagga
cgccctggcccttatgacatacgtgatcgtggtgccaaccgtggtggcaatgatttcggc
ggagggcgcaatgattggggcaacaatggcaactttggcgttggtgccaacaacatgctg
ggcttcaacaatctgccaagcctgatgaactcgggcaactttggaaacaaccaaggtgga
aataatggaaattttggaaataactctggacccagcaatttcggcaactttggtggcggc
aacaacggtggaaattccggcaactttggaaacgacagtggtaacagcggaaactttgga
aacttcggcaataatggaggcggaaacttcggcggcaacaacaacggcggcggtggtttc
aacagtggcaacaacttcaattctccaggtggcgttaataatttcggcaacaatggcggc
tccaattttggcggcaatggtggaggaggtttcaataacggcggaaacttcgtatcctcg
agtggtgttggcaactttggcccgatcggcggcggtcgcaacaataacaacggaaatttc
ggaaactctggattcggtaactttggaggaaacaacaatgtcggctcgaacttcggagga
ggcaacaacggcggtggcggcggattcaacaatggctcgaacttcggcggcggcaactca
atgggcggtggtggcaatttcggtcccatcggcggcggtcggggcaacgacatcgagtat
tatacaatccacatgcgcggacttccctacacttcatttgaaaacgacgtttttaagttc
ttcgaaccaatccgaccagctaacgtgcggataaactacaacaagaagggtctgcacagt
ggcactgcggatgcctacttcgacacctacgaggattcccaggtggccatgaagcgccac
agagagcagatgggttcgcgatacattgagctgttctacgacggaaagacgcgtggactc
aatggtggggaacacggcggtggtaacggtggcggcggaatgggaaacaatggcggcgga
aacttttcgcggcgcatctaa

DBGET integrated database retrieval system