KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7007
Entry
Dmel_CG7007       CDS       T00030                                 

Gene name
VhaPPA1-1
Definition
(RefSeq) vacuolar H[+] ATPase PPA1 subunit 1, isoform B
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00190  Oxidative phosphorylation
dme01100  Metabolic pathways
dme04142  Lysosome
dme04145  Phagosome
Module
dme_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dmel_CG7007 (VhaPPA1-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG7007 (VhaPPA1-1)
   04142 Lysosome
    Dmel_CG7007 (VhaPPA1-1)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 45247
NCBI-ProteinID: NP_001247111
FlyBase: FBgn0028662
UniProt: Q9VFE3
Position
3R
AA seq 212 aa
MAAQIRTVVSQTFLWLFLAVATILTLYFVMTGKGERVSVGWFLASSNPYMWACLGIGLSV
SLSVVGAALGIHTTGTSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGQLEQF
SMETALSQAAIQNTNWFSGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANAALFVK
ILIVEIFGSAIGLFGLIVGIYMTSKSKMGDKE
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcggcccaaatacgcaccgtggtgtcccaaacgttcctgtggctcttcctcgccgtg
gccaccatcctgaccctgtacttcgtgatgacgggcaagggcgagcgggtgagcgtgggc
tggttcctggcctcctcaaacccgtacatgtgggcctgcctgggcatcggactctccgtc
tcgctgtccgtcgtgggcgccgccctgggcatccatacgacgggcacgagcatcgtgggc
ggtggtgtgaaggcgccccgcatcaagaccaagaatctgatctcggtcatcttctgcgag
gccgtggccatctacggcctgatcaccgccatcgttctgtccggccagctggagcagttc
tcgatggagacggccctttcgcaggcggctattcagaacacgaactggttctccggctac
ctcatcttcggtgctggcctggctgtcggcctggtcaatctgttctgcggcattgctgtg
ggcattgtgggttcgggtgccgccctctcggacgccgccaatgccgccctgttcgtcaag
atccttattgtggagatcttcggttcggccatcggtctgttcggcctcatcgtgggcatc
tacatgacctccaagtccaagatgggcgacaaggagtag

DBGET integrated database retrieval system