KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7057
Entry
Dmel_CG7057       CDS       T00030                                 

Gene name
AP-2mu
Definition
(RefSeq) adaptor protein complex 2, mu subunit, isoform C
  KO
K11826  AP-2 complex subunit mu-1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmel_CG7057 (AP-2mu)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG7057 (AP-2mu)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    Dmel_CG7057 (AP-2mu)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s
Other DBs
NCBI-GeneID: 42642
NCBI-ProteinID: NP_001163686
FlyBase: FBgn0263351
UniProt: O62530
Position
3R
AA seq 437 aa
MIGGLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKR
ANIWLAAVTKQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGY
PQNTDSGTLKTFITQQGIKSATKEEQMQITSQVTGQIGWRREGIKYRRNELFLDVLEYVN
LLMSPQGQVLSAHVAGKVVMKSYLSGMPECKFGINDKIVMESKGRGLSGNSEAETSRSGK
PVVVIDDCQFHQCVKLSKFETEHSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGR
TKMEVKVVLKSNFKPSLLGQKIEVKIPTPLNTSGVQLICLKGKAKYKASENAIVWKIKRM
AGMKETQLSAEIELLETDTKKKWTRPPISMNFEVPFAPSGFKVRYLKVFEPKLNYSDHDV
VKWVRYIGRSGLYETRC
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgattggcggcctgttcgtctacaaccacaagggcgaggtgctgatctcgcgagtttac
cgcgacgacatcggtcggaatgccgtggacgcctttcgggtcaacgtcatccacgcccgc
cagcaggtccgctcgccagtgaccaatattgcgaggaccagcttcttccacatcaagaga
gcaaacatttggctggcggctgtgaccaagcagaatgtgaacgccgcgatggtgtttgag
ttccttttgaagatcatcgaggtgatgcaatcctacttcggcaagatctcggaggagaac
atcaagaataacttcgtgctcatctacgagctgctggatgagatcctcgactttggctac
ccgcagaacacggactccggcaccctgaagaccttcatcacacagcagggcatcaagtcg
gccaccaaggaggagcagatgcagataacctcgcaggttaccggccagattggctggcgt
cgcgagggcatcaagtaccggcgcaacgagcttttcctggacgtattggagtacgtgaac
ctgctgatgagcccgcagggtcaggttttgtctgcccacgtggccggcaaggtggtaatg
aagtcgtatttgtcgggcatgcccgagtgcaagttcgggattaacgacaagatcgtgatg
gagtctaagggacgcggtctctccggaaattcagaggcggaaacctcacgctccggcaag
cccgtcgtggtcatcgatgactgccagttccatcagtgcgtcaagctaagcaaattcgag
acggagcattcgatcagcttcatcccgccggacggggagttcgagctgatgcgttaccgt
accaccaaagacatttcgctgccattccgagtcatcccgctggtgcgggaggtgggccgc
accaagatggaggttaaggttgtgctgaagtccaactttaagccctcactgctgggccaa
aagatcgaggtgaagataccaaccccgctcaatacatcgggcgtgcagctcatctgccta
aagggcaaagccaaatataaggcttcggagaacgcgatcgtgtggaagattaagcgcatg
gcgggcatgaaggagacacagctgtccgcggaaatcgaacttttggagacggacaccaag
aagaagtggactcggccgcccatctccatgaactttgaggtgccattcgcgccgtccggc
ttcaaggtacgctacctgaaggtgttcgagcccaagctcaactactccgaccacgatgtg
gtcaaatgggtgcgctacatcggacgcagtggcttgtatgagacgcgctgctag

DBGET integrated database retrieval system