KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7068
Entry
Dmel_CG7068       CDS       T00030                                 

Symbol
Tep3
Name
(RefSeq) Thioester-containing protein 3
  KO
K06530  CD109 antigen
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG7068 (Tep3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dme04090]
    Dmel_CG7068 (Tep3)
Peptidases and inhibitors [BR:dme01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   Dmel_CG7068 (Tep3)
CD molecules [BR:dme04090]
 Proteins
  Dmel_CG7068 (Tep3)
SSDB
Motif
Pfam: TED_complement A2M_recep A2M A2M_BRD MG2 MG3 MG1 MG4
Other DBs
NCBI-GeneID: 34045
NCBI-ProteinID: NP_523507
FlyBase: FBgn0041181
UniProt: Q9VLY7
Position
2L
AA seq 1469 aa
MRLQGADMGAIPVLILVTACLLCQTSAQGLYSIIAPNTLRPNSQFHVAVSLHNAPESATF
KVGILGSSYTDFKTVELRPFSTQLLHFEIPALRTDRYRLTAEGLGGVQFTNETQLHFESK
QHTVLVQTDKSIYKPGDLVHYRVLILDANLKPARGYGRVHVDIKDSGDNIIRSYKDIRLT
NSIYSNELRLSDSPRFGTWSIVVDVSDQEHTQTFEILDHILPKFVVDIDTPKHAIYKDGK
IAATVRAHYAFGQPIVGEATLSIYPTFFGSLQPFVNDLITRKVVPIDGNAYFEFDIENEL
HLKQDYERQYLLDALVEEKSTGSVQNYSTVLTLHLNHYRVEAVKVPSYYIPGVPFEATAR
IARNDGGQLRDFNPQITAYLTNVYGSSEMYNRTAYSLDASGEIKMKFTVPIGDRDEFHSI
IVDYQGVISEVGKIPSKHLHSKNYITAKVLNDRPTVNQEISVVVRSFAPIKYFMYQVVGR
GDIILSRNVDVAPGTFHTIKFLASFAMMPRANLLVYTVIDGEFVYDEQVIQLEENLLNAV
QVDAPIRAPPGQDIDIGISTKPYSYVGLMLVDQNANDLRSGHDLTHKRLMDALRSYELSD
VNTPMGSPGKESGVITMSNTDYFIEKEAESNPALDREVSTGPEEDKLTTVRKTDIGPAHK
IEVNTLPPGKGRYAFSYTPKPFWHNPRVHVMRDPADTWLFLNISASSDGRNSIHRRIPSE
MTSWVVSAFALDPVNGLGLSPPNGKLEAYKEFYISTELPYSIKRDELIAIPFVVHNNRDS
DLNVEVTFYNSALDFDFPQLDPKATNQPKVELYRRRSLQVPGRSARSVSFIVTPKRVGPL
LVKAMAASSQAGDTVEQNLLVEHPGAMERINRGFLFELNSNAQNRRNVTIAVPRNAIPES
TRIEVSAVGDLIGSLVGNLDSLILLPTGCGEQTMVNFVPNLIVLRYLGRLRQLTPEVELR
ATNNLAIGYQRILYYRHENGAFSAFGLDIKRSSTWLTAYVARSLRQAAPFTQVDSNVLQK
ALTYLGSVQSANGGFEERGDVFERFGDDGISLTAFVTLALMENVDLYPEYRNNINKALDF
ITRGLDGSSNLHAMAIGTYVLSRANHNAKAAFLQRLDSMATNKDGLKWWNKTAPAGEQQS
PWYNATRSVNIEISAYAALALLENNLVGDALPVLNWLMDQRNPKGGFVASQDTVVGLQAL
LMFAERFSSQGNNLQIGFHYGEGAETIINVNAENSLALQTVELPNNLKNLSVSATGRGMA
LAQVSYTYNTNVTSAWPRFVLDPTVNRNSHADYLHLSACASFVSVVGENEQRSNMAVMEV
HLPSGFVVDRDTLPTLESSERIKKVETQNRNTKVVIYFDYLDRREVCPTLHAYKTVKVTK
HRPVAVVMYDYYDSARRARQFYRAPKSNICDICEHANCGDLCEKAEKRESKRPDDYTAIA
GHSSGSRHTAIPLASVVMVLSMLLKTLSC
NT seq 4410 nt   +upstreamnt  +downstreamnt
atgcgcctccagggagcggatatgggcgctattccagtgctaatcttagtcaccgcttgt
ttgctttgccaaacatctgcccagggtttatactccatcattgctccgaatactttgcgt
ccgaactcgcaatttcatgtggctgtgagcttgcacaatgcacctgaatctgccacattt
aaggtgggaatcctggggagctcttacacggactttaagaccgtggagttacggcccttt
tccacacagctattgcactttgagattcccgccttaagaactgacagatatcgcctaact
gctgagggccttggaggagttcagtttaccaatgagactcaactgcactttgagtccaaa
caacatacggttttggttcagacggacaagagcatctacaagccaggcgatttggttcac
tatcgagttcttattttggatgccaatctgaaacccgcgcgtggctatggacgtgtgcat
gtggatatcaaggactccggtgataacattatacgcagctacaaagacattcgtctgacc
aattccatttactcgaacgaactgcgattgtcggactccccgcgttttggcacttggtcc
attgtcgtggatgtttcggatcaagagcatacgcaaactttcgagatccttgatcatatt
ctaccaaaattcgttgtagacatcgatacacccaagcacgctatttataaggatgggaaa
atagcagccacagtcagagcgcactatgcatttggccagccaattgtgggtgaagccacc
ctatccatttatcccactttctttggctcgctccaaccttttgttaacgatctcatcacc
cgaaaagttgtgccaattgatggtaatgcgtactttgagttcgatatagagaatgagctc
catctgaagcaggactatgagcgacaataccttttggatgccctcgttgaagaaaagtca
actggttcggtgcaaaactattcaacagtcttgacactgcacttgaaccattatcgcgtg
gaggccgtcaaggtgcccagctactatattcctggagtgccctttgaagctacagctcgc
atagcccgcaatgatggcggccaattgagggacttcaatccccaaatcaccgcatatttg
acgaatgtctatggcagcagtgagatgtacaaccgtactgcctatagcctggatgccagt
ggagagatcaagatgaagttcactgttccgattggagatcgagatgaatttcattccata
atagttgactaccagggcgtgatcagtgaggtgggaaagatcccgagtaagcatttgcac
agcaaaaactatatcactgctaaagtgttgaatgatagacccactgtaaaccaggaaatt
tctgtggtcgtacgctcctttgcgcccattaaatattttatgtaccaagttgtcggtcgc
ggcgatattatactgtctcgcaatgtggatgtggcccctgggactttccacacaatcaaa
ttcctggcatcatttgcaatgatgccgagagccaatctgctcgtatatacggtaatagat
ggggagtttgtttacgatgagcaggtcatacagcttgaagaaaatctactcaatgcggta
caagttgacgctcccattagagcacctcctggtcaagatattgacataggcataagcacc
aaaccctactcatatgtgggcctcatgttagtggatcaaaatgcaaacgaccttaggagt
ggtcatgatttaacccacaaacgactgatggatgctctgcgttcatacgaactgagcgat
gtgaacactccaatgggatcacctggcaaggagtctggtgtgataaccatgtccaatacg
gattactttatcgaaaaggaagctgagagcaatccggctttggatcgagaggtttccacc
gggcccgaggaagacaaattaacgactgtgcgaaaaaccgacattggacctgcccacaag
atcgaggttaatacgttgcctcctggaaaaggccgatacgccttttcttataccccaaag
cccttttggcataatccaagggtccatgtgatgcgcgatcctgcggatacgtggctcttc
ttaaacatctccgccagcagcgatggaaggaattcaatccacagaaggattcccagtgag
atgacatcctgggtggtttccgcctttgctctggatccggtgaacgggttgggattatct
ccgcccaatggaaaattggaggcctacaaagagttttacataagcaccgagttgccctac
tccataaaaagagatgaactcattgccattccgtttgtggtgcacaacaatagggacagt
gatttgaacgtggaggtcacgttttacaactcagcgctggactttgatttcccacaactg
gatcctaaggccaccaaccaaccaaaggtggaactctacagacgtagatccttgcaggta
ccgggacgatccgcccgctccgtgtccttcatcgtgactccgaagagagtggggcccctc
ttggtcaaggcaatggctgcctcctcccaggctggcgatacagtcgaacaaaatctgctg
gtggagcaccctggagccatggagcggatcaacagaggattcctcttcgaacttaactcc
aatgcccagaatagaaggaacgtcaccattgcggttccacgcaacgccattccggaatcc
acacgtattgaagtatcagccgttggcgatctcattggcagcttagtgggtaatctggat
agccttatccttctgccaacaggctgcggcgaacagaccatggttaattttgtaccaaat
ctaatagtattacgttacttagggcgccttcgtcaactcacgcccgaagtggaactgcgt
gccacaaacaatctggctataggctaccagagaattctttattatcgccatgagaatggt
gccttcagtgcatttggattagatatcaagcggagttccacctggctgacagcgtacgtg
gctcgctcacttcgacaagcggctccattcactcaagtggatagcaatgtcctgcaaaag
gcactaacctatttgggaagtgttcaatcagcaaacggtggcttcgaggagcgtggcgac
gtattcgagagatttggcgacgatggcatcagtctgactgcatttgtgacactggctctg
atggaaaatgtggatctgtatcccgaatatcgaaacaacatcaacaaagccctggacttt
atcaccaggggcttagatggatcaagtaacctgcacgccatggccataggcacttacgtg
ctctcccgagctaatcataatgccaaggcagcttttcttcagcgattagactcaatggcc
accaacaaggatggcctcaagtggtggaacaaaacggcgcccgctggtgagcaacaatca
ccctggtataatgccactcgtagcgtcaacattgagatctccgcttacgccgccttggct
ctactggaaaataacttggtgggcgatgccctgcccgtcttgaactggttgatggaccag
cgaaatcccaaaggtggttttgtggcatcgcaggatactgtagtcggccttcaggcgctt
ctcatgttcgccgaacgcttttccagtcagggcaataatctccaaatcggcttccattac
ggagaaggcgctgaaacgataattaatgtgaatgccgaaaactcactagccctgcaaacg
gtggagctgccaaacaatcttaaaaacttgagtgtttcggccactggtcggggaatggca
ttggcccaagtcagctacacctataacacaaacgtgaccagtgcctggccacgatttgta
ctcgatcccactgtgaatcggaactcccatgcggactacctccatctttcggcctgtgcc
agctttgtttccgtggtgggcgagaacgagcagcgctccaacatggccgtgatggaggtt
cacctgcccagcggtttcgtcgtggacagggatacacttcccaccctggagtcgagtgag
cgcatcaagaaggtcgagacccagaacaggaacaccaaagtggtcatctactttgattac
ctggacagaagggaggtgtgtcccaccctgcacgcttacaagacggtcaaggttacaaaa
catcgaccggtggcagtggtcatgtacgactactatgacagcgctcgccgtgccagacag
ttctacagggcacccaaatccaatatctgtgacatttgcgagcacgccaactgcggtgac
ctatgcgaaaaggccgagaagcgcgagtccaagcgacctgatgactacacggcgatagcg
ggtcatagttcagggtcaagacacacagccattccactggcatctgtggttatggttctg
tcgatgcttttgaaaacccttagctgttag

DBGET integrated database retrieval system