KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7123
Entry
Dmel_CG7123       CDS       T00030                                 

Symbol
LanB1
Name
(RefSeq) LanB1, isoform A
  KO
K05636  laminin, beta 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dmel_CG7123 (LanB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 34068
NCBI-ProteinID: NP_476618
FlyBase: FBgn0261800
UniProt: P11046
Position
2L
AA seq 1788 aa
MLELRLIVVIVLALLSWQWDPVDSQRPPQHGRRDRPKYPPNKFIKTHPCERSSCYPATGN
LLIGRENRLTASSTCGLHSPERFCILSHLQDKKCFLCDTREETKHDPYKNHRIGQIIYKT
KPGTNIPTWWQSENGKENATIQLDLEAEFHFTHLIITFTTFRPAAMYIERSFDFGQTWHI
YRYFAYDCKESFPGVPTVLENITDVMCTSRYSNVEPSRNGEVIFRVLPPNINVTDPYAEH
VQNQLKMTNLRIQMTKLHKLGDNLLDSRLENEEKYYYGISNMVVRGSCSCYGHASQCLPL
DPAFSQADNEDGMVHGRCECTHNTKGMNCEECEDFFNDLPWKPAFGKKTNACKKCECNDH
AVSCHFDEAVFTASGFVSGGVCDNCLHNTRGQHCEECMPYFYRDPEQDITSERVCQPCDC
DPQGSSDDGICDSLNELEEGAVAGACHCKAFVTGRRCNQCKDGYWNLQSDNPEGCEPCTC
NPLGTLNNSGCVMRTGECKCKKYVTGKDCNQCMPETYGLSESPEGCSLCNCDAGGSYDNY
CDVISGQCRCRPHMTGRSCSQPKQNYFIPLLPEVHEAEVVDECISYGANGNCSLVAETPD
GSFTGIGFTRVPENSELVFTVGDIPRSMPYDAVIRYQSTSRGDWENAFITLVRPDQVDPE
GGCGELAAATSSETRIPFSLPDRSRQVVALNEVCLEAGKVYKFRIYFERKRHDVDSPTAT
ILVDSLTLIPRIDVTPIFQGSVLADIRKKDYEKYNCKSSLYDMNYKSDPKCQNLDNILSV
FVHDGASMCNCNPTGSLSKVCESNGGYCQCKPNVVGRQCDQCAPGTYGFGPEGCKACDCN
SIGSKDKYCDLITGQCQCVPNTYGRECNQCQPGYWNFPECRVCQCNGHAATCDPIQGTCI
DCQDSTTGYSCDSCLDGYYGNPLFGSEIGCRPCRCPETVASGLAHADGCSLDTRNNNMLC
HCQEGYSGSRCEICADNFFGNPDNGGTCSKCECSNNVDLYDTGNCDRQTGACLKCLYQTT
GDHCELCKDGFFGDALQQNCQQCECDFLGTNNTIAHCDRFTGQCPCLPNVQGVRCDQCAE
NHWKIASGEGCESCNCDPIGALHEQCNSYTGQCQCKPGFGGRACNQCQAHYWGNPNEKCQ
PCECDQFGAADFQCDRETGNCVCHEGIGGYKCNECARGYIGQFPHCSPCGECFNNWDLIL
SALEDATTATILRAKEIKQVGATGAYTSEFSELDKKLQHIRNLLQNTSVSLVDIEKLDYE
TQSLRDQLQASHGRLSETEQNLDDIYNSLSLSGVELESLQNHSRLVQQLSKELKENGIQL
QESNIEGALNLTRHAYERVSNLSTLKDEANELASNTDRNCKRVENLSNKIQAEADDLANN
NKLIEDYRAELTSLTSQIPELNNQVCGKPGDPCDSLCGGAGCGHCGGFLSCEHGAKTHSE
EALKVAKDAETAITSKKDQADQTIRALTQAKLNASEAYEKAKRGFEQSERYLNQTNANIK
LAENLFIALNNFQENKTASPSESKELAQKTLDLDLKLEPEEIETLGDQINRAVSSLKNVE
AIIYRTKPDLDRVNNLQSIANATKEKADKILDSANSVVESLAAADESQGKAKDAIQQANS
NIELAGQDLEKIDEETYSAEAPANNTAQQVEKLAKKVQKLQNNIMKNDRDAKEITKEAGS
VKLEAMRARGEANNLQSATSATNQTLTDRASRSENARERAKQLLQRASKLTVDTNAKLKD
LNDLQTVYLNKNQQLLRLQAEIGPLNKELNEHLIHIKERGSHYRQCYT
NT seq 5367 nt   +upstreamnt  +downstreamnt
atgttggagctgcggcttatcgtggtcattgtgctcgccctgctcagctggcagtgggac
ccagtggactcccaaagaccgccccagcatggccgacgtgatcgtccgaaatatccaccg
aacaagtttatcaagactcatccatgcgagagatcctcctgctacccggcaacgggtaat
cttctgatcggccgagaaaaccgcctgactgccagttccacgtgtggtctgcactcgccg
gagagattctgcatcctgtcccatttgcaggataagaagtgtttcctctgcgacacgcgt
gaggagaccaagcatgatccgtacaaaaatcatcgcatcggacagattatatataaaact
aagccaggcaccaacatacccacctggtggcagtccgagaatggcaaggaaaatgctacc
attcaactggatctggaggcggagtttcactttacccatttgatcataaccttcaccacc
ttccgaccagcggccatgtacatcgagagatcctttgatttcggacagacgtggcacatc
tacagatatttcgcctacgactgcaaggaatcctttccgggagtgcccactgtcttggaa
aacatcaccgatgtcatgtgcacctcgaggtattccaacgtggagccctcgaggaatggt
gaagtgatatttagggtgctgccaccgaacatcaacgttaccgatccctatgcggagcac
gtgcagaatcagctgaagatgaccaatctgaggatccagatgacgaagctgcacaagctg
ggagacaatcttttggatagcaggctggagaacgaggagaagtactattatggcatctcc
aacatggtggttcgcggatcctgctcctgctatggccacgcctctcagtgtctaccgttg
gatcccgcattttcccaggcggacaacgaagatggcatggtgcatggccgatgtgagtgt
acccacaacaccaagggaatgaattgtgaagagtgcgaggatttcttcaacgatctccca
tggaaacccgcttttggaaagaaaacgaatgcctgtaagaaatgtgagtgcaacgatcac
gccgttagttgtcacttcgatgaggctgtcttcactgcatccggtttcgtttccggcgga
gtgtgcgacaattgcttgcacaatactcggggtcagcattgcgaggagtgcatgccgtac
ttctaccgcgatccagagcaggatataacgtccgaaagggtttgccagccctgtgactgc
gatcctcaaggttcgtcggacgacggcatctgtgactccctaaatgaactggaggaggga
gcagtagcaggtgcctgccattgcaaggcctttgtcacgggacgtcgttgtaatcagtgc
aaggatggttactggaatctgcagtcggataaccccgagggctgcgagccgtgcacctgc
aaccccctgggtacactgaacaactccggatgcgttatgcgcaccggcgagtgcaagtgt
aagaaatatgtgacgggcaaggactgtaaccagtgtatgccggagacctatggtctttcg
gaatctccggagggttgctctctgtgtaactgcgatgctggtggatcctacgataattac
tgcgatgtcataagtggtcagtgtcgctgcaggccccacatgacgggtaggtcatgttcg
cagccgaagcagaattacttcattcccctgctgcccgaggttcatgaagcagaggtggtg
gacgagtgcatctcgtatggcgccaacggtaactgcagcctggtggccgaaactcctgat
ggcagtttcacgggcattggttttaccagggttcctgagaactcggaactggttttcact
gtcggagatattcctcgatccatgccatacgatgcggttatacgttaccagagcacttca
cgaggagattgggagaacgcctttatcactcttgtcagacccgatcaagtggatcctgaa
ggaggatgcggtgaactagctgcagcaacttcttcggaaaccaggattccgttctccctt
cctgatcgcagccgtcaggtggttgctttgaatgaagtatgcttggaagctggaaaggtt
tataaattccggatttactttgagcgaaagcgacacgatgtggacagtcccacagcgacg
atcttggtggattctcttacgctcattccccgcatcgatgtaacgcccatcttccaagga
tccgttctggctgatattcgcaaaaaggattacgaaaaatacaattgcaaatcctctttg
tacgatatgaactacaagtcggatcctaaatgtcaaaatctggacaatatcctcagtgtg
tttgtccacgatggagccagtatgtgtaattgcaatccaaccggatcgctgagcaaggtg
tgcgaatccaatggaggttactgccaatgtaagcccaatgtggtgggcaggcagtgcgat
cagtgtgctccgggcacctatggttttggtcccgaaggttgcaaggcttgcgattgcaac
agcatcggatcgaaggataaatactgcgacctgataaccggccagtgccagtgtgtgccg
aatacatacggcagggagtgtaatcagtgccagccgggctattggaatttccccgagtgc
agagtgtgccagtgcaatggtcatgcggccacgtgtgatcccattcaaggaacctgtata
gattgtcaggactcgaccacgggctatagctgtgacagctgtttagatggatattatgga
aacccacttttcggcagtgagatcggatgccgaccatgccgctgcccggagacggtagcc
agtggcctggcgcacgcagatggctgctccctggacacacggaacaataacatgttgtgc
cactgccaggagggatattccggctcccgttgcgagatctgtgcggacaacttctttggc
aatccggacaacggtggtacctgctccaagtgcgagtgcagcaacaatgtcgatctttat
gacactggaaactgtgatcggcagacgggagcttgtctaaagtgcttgtatcagacgact
ggcgatcactgcgagctctgcaaggatggattctttggggatgcactgcagcagaattgc
cagcagtgcgaatgcgatttcctcggaacgaataataccatagctcattgcgatcgtttt
acgggtcagtgcccctgcttgccgaatgtccagggtgtgcgttgtgatcagtgtgccgag
aaccactggaagattgcctctggcgagggttgtgaaagctgcaactgcgatccaattgga
gcactccatgaacagtgtaattcctacacggggcaatgccaatgcaagccaggatttggc
ggcagagcgtgtaatcagtgccaggctcattactggggcaatcccaacgagaagtgccag
ccgtgcgagtgcgatcagtttggagctgctgacttccagtgcgaccgggagacgggtaat
tgcgtctgtcacgagggaattgggggctacaagtgcaacgagtgcgccaggggctatatt
gggcagtttccacactgctcaccttgtggcgaatgcttcaacaactgggatttgattttg
agtgctctggaggatgccacaactgccactatcctacgagccaaggaaatcaagcaagtg
ggagcgacaggagcctacacgtccgagttcagtgaactggataagaaattgcagcacatt
aggaatctgctgcagaacacctcggtcagtctggttgatatagagaaactggactatgaa
acccaatcacttagggaccaacttcaggcgtcccatggccgattaagtgaaaccgagcaa
aacctggatgacatttacaattcgctaagtttgtcgggcgttgagctagagagcctacaa
aatcactccagattggtgcaacaactgtccaaggaactgaaggaaaacggcatacaactg
caggagtcaaatatcgagggagctttgaacctcacacgtcacgcctacgaaagagtcagc
aatttgtcgacccttaaagacgaggccaatgaacttgcatcgaacaccgataggaattgc
aagagagtggaaaatctgtctaataagattcaggccgaagccgatgacctggcaaacaat
aacaagctcattgaagactaccgagcagagttgacttcgctaacctcccaaattcccgag
ctgaacaatcaggtttgcggcaagccaggtgatccctgtgatagtttgtgcggaggtgct
ggctgcggtcattgtggcggtttcctgtcctgcgaacatggcgccaaaacccattcggag
gaagcccttaaggtggccaaggatgctgagacggccattaccagcaagaaggatcaggcg
gaccaaaccatcagggctctgacccaggccaaactgaatgcctccgaggcatatgagaag
gccaagaggggtttcgaacaatccgagcgttatctgaaccaaaccaatgccaatatcaag
ctggccgaaaacctattcatagccctcaacaatttccaggagaacaagacagcttctcct
tcggagagcaaagaactggcacagaaaactctcgacttggacctgaaactggaacccgaa
gagattgagaccctcggcgaccaaatcaacagggctgtctcatcgctaaagaatgttgaa
gccataatctacaggaccaaacccgatttggacagggtcaataatctgcagagcattgcc
aatgccaccaaggagaaggccgataagatcctggactctgccaattcggtcgtggagagc
ctggcggcggcagatgaatcccagggtaaagccaaggatgccattcagcaggcgaacagt
aacattgagttggccggtcaggatctggagaagatcgatgaggaaacgtattccgccgaa
gctccggccaataacacagcacagcaggttgagaaattggccaagaaagtgcagaaactg
cagaataacataatgaagaacgatcgggatgccaaggagataaccaaggaagcgggtagc
gtcaaactggaggccatgagggctcgcggagaggccaataatcttcagtctgccacaagt
gccaccaatcagaccctcaccgatcgcgccagtcgctccgaaaatgccagggaaagggcc
aagcagctgctccagagggcctccaaactaacagtcgatacgaacgccaagctaaaggat
ctgaacgatctgcagaccgtctatctgaacaagaaccaacaactactgcgattgcaggcc
gagatcggccccttgaacaaggagctcaacgagcacctgattcacatcaaggagcggggg
tcgcactacaggcagtgctatacgtag

DBGET integrated database retrieval system