KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7219
Entry
Dmel_CG7219       CDS       T00030                                 

Symbol
Spn28Dc
Name
(RefSeq) serpin 28Dc
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 34091
NCBI-ProteinID: NP_609172
FlyBase: FBgn0031973
UniProt: Q9VLU4
Position
2L
AA seq 536 aa
MWRLLLALLLVSSVCCESELFRDDLRTPETMAYINGLMQRRHQMQQEAQQHIQAIPPAVP
LQSPGLVNGLGNQNDPALNRISGTSVKPSNLPAAYSNGYVDLATSDRIANSVLNFANILG
QHLANGKTQIYSPLSIVHSLALLLLGAKGRSYEELSTVFDIPDTSRLHEQFGLMLQDLQQ
PTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFTQTGYTLNPDYRRVIVEV
YASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASDIPQTTRMILANALYFKAFWE
TDFIESATRPDNFYPNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMY
IIQPFKSSVRELMALQKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGL
GGIFSAVQNDLSLIATNEATRTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFT
VNEQGTEAAASSVTYLKKSGPDVLFRGDTPFMVLVRHDPTKLVLFYGLINEPPAAA
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgtggcgcttgcttttggcacttttgctcgtgagttcggtgtgctgtgaatcggaacta
tttcgtgatgacctgaggaccccggaaacgatggcctacatcaatggactgatgcagcgg
cggcatcagatgcaacaggaggcgcagcagcacattcaggcgataccgcctgcggtgccc
cttcaatcgcccggccttgtgaacggccttggcaaccagaatgaccctgcgttgaatcgc
atatccggcacttcggtgaaaccttccaaccttccggctgcctactccaacggctatgtg
gatctggccacctctgatcggattgcgaacagtgtgctgaactttgccaacattctgggc
cagcatttggccaacggtaaaacccagatatactctcccctgagcattgtacactcgctg
gctctgctgctcctgggcgccaagggtcgcagttacgaggagttgtccacggtcttcgat
attccggacacgtccaggctgcacgaacagttcggcctgatgctgcaggatctgcaacag
cccaccagggaggcgatctccgcaggacgaccgctgaccgattggcgggcgagcagcgcg
atgagatccaatcgacgggcccagcgacccggtgctcatgaggtgcacctggccaatgga
ctgttcacacagaccggctacacactcaatcccgactacagacgggtgatcgtcgaggtc
tacgcctcggatctgcagattcaggatttcgagggcagtccggcgacagcacgatacaat
atcaatgcttatgtggcgcagcacacaaagaatcacatcgagaacatcatcgccagcgat
attccgcagaccaccaggatgattctggccaacgcattgtactttaaggcattctgggaa
acggactttatagagtcagccacacgtccggataacttctatccgaatggcgagggaacg
gagccggtgatgagggtgcagatgatggccaccggtggtgcatatccgtatcacgaggat
cacgagctgggctgcaagatcattggactgccgtacaggggaaatctgagcaccatgtac
atcatccagccgtttaagtcgtcggtgagggagctaatggcactgcagaaacgtctgacg
gcggataagatcgagagcatgatcagccgaatgtacagacgggccgctctggtggcattc
ccaaagatgcatcttacggagtcggtgaacttgaagacagtcatgcagcgaatggggctg
ggcggcatctttagcgcggtgcagaatgatctctcgctcatcgccaccaacgaggccacg
aggacgaatgcgctgggcggcaacagcctgcagaatctggaggcacagcgcagagccgga
acgggtggagcacgttccgatctggtggtggatgacattgttcacaaagtggacttcacc
gtcaacgagcagggcacggaggcggcggcgtcttcggtcacatacctcaagaaatccggt
cccgatgtcctcttccgcggagacactccattcatggtccttgtgcgccacgatcccacg
aaactggtgctcttctacggactcataaatgagcccccggcggccgcttag

DBGET integrated database retrieval system