KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7279Help
Entry
Dmel_CG7279       CDS       T00030                                 

Gene name
Lip1
Definition
(RefSeq) lipase 1, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydro_lipase Abhydrolase_1 Hydrolase_4 Radial_spoke Tr-sialidase_C
Motif
Other DBs
NCBI-GeneID: 43973
NCBI-ProteinID: NP_001285811
FlyBase: FBgn0023496
UniProt: O46107 X2JDS0
Position
2L
AA seq 439 aa AA seqDB search
MRCSLRMQLLLLLGLCVFISRIQGQLIGGEEDEEDEEEEEEEEESVEDETPEDRLQRKNI
KQDSTLSVDKLIAKYGYESEVHHVTTEDGYILTMHRIRKQGAPPFLLQHGLVDSSAGFVV
MGPNVSLAYLLADHNYDVWLGNARGNRYSRNHTTLDPDESKFWDFSWHEIGMYDLPAMID
HVLKVTGFPKLHYAGHSQGCTSFFVMCSMRPAYNDKVVSMQALAPAVYAKETEDHPYIRA
ISLYFNSLVGSSIREMFNGEFRFLCRMTEETERLCIEAVFGIVGRNWNEFNRKMFPVILG
HYPAGVAAKQVKHFIQIIKSGRFAPYSYSSNKNMQLYRDHLPPRYNLSLVTVPTFVYYST
NDLLCHPKDVESMCDDLGNVTGKYLVPQKEFNHMDFLWAIDVRKMLYRRMLQVLGKVPEG
SPEEANRSRREIRGKFIRS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcagcctgaggatgcagttgctcctgctcctgggactctgtgtgttcatctcc
aggatccaaggccagctgattggcggcgaggaggacgaagaggacgaggaggaggaagaa
gaagaggaggagagcgtcgaggacgaaacgccggaggatcgactgcagcgcaagaacatc
aaacaggattcgactctcagtgtggacaaattaatcgccaagtacggctacgagtcggag
gtgcaccatgtgaccaccgaggacggatacattctcaccatgcatcgcatccgcaagcag
ggcgccccgcccttcctcctgcagcacggactcgtggacagctcggcgggatttgtggta
atggggcccaacgtgagcctggcctacttgctggccgaccacaactacgatgtctggctg
gggaacgcgcgtggcaatcgctactcgaggaatcacaccaccctcgacccggacgagtcc
aagttctgggacttcagttggcacgagatcgggatgtacgacttgccagcgatgattgat
cacgtgctaaaggtgaccggattcccgaaactgcactacgccggccactcgcagggatgc
acctctttcttcgtgatgtgctccatgcgtccagcctacaacgacaaggtcgtttccatg
caggccctcgcacccgccgtttatgccaaggagaccgaggaccacccctacattcgggcc
atcagtctgtactttaatagcctggtaggcagctcgattagggagatgttcaatggggag
ttccggtttctatgccggatgacggaggagacggaacggctgtgcatcgaggccgtattt
ggaatagtgggtcgcaactggaacgagtttaacaggaaaatgttccctgtgatcctgggt
cactacccggcaggagtggctgccaagcaggtgaagcacttcattcagatcatcaagagc
ggtcgctttgctccttatagctacagttccaataagaatatgcagttgtacagggatcac
ctgccacctcgttacaacctgagtctggtgacggtgcccactttcgtgtactactctacc
aatgatctgctttgccaccccaaggatgtggagtccatgtgcgatgacctgggcaacgtg
acgggcaagtacctggtgccgcagaaggagttcaaccacatggacttcctctgggccatc
gatgtgcgaaaaatgctctatcgccgtatgctgcaggtcctcggaaaagtgccagagggc
tcgccagaagaggctaatcgatccagaagggaaatccggggaaaattcatacgttcttaa

DBGET integrated database retrieval system