KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7329
Entry
Dmel_CG7329       CDS       T00030                                 

Gene name
CG7329
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydro_lipase Hydrolase_4 Chlorophyllase2
Other DBs
NCBI-GeneID: 34457
NCBI-ProteinID: NP_001260357
FlyBase: FBgn0032271
UniProt: Q9VKT2
Position
2L
AA seq 457 aa
MPHAICILVVLGIYTLDGSGVLGGFMENTYPASVIEDAHLNTIQLLEKYKHPAETHQVTT
DDKYILTLHRIARPGAKPVLLVHGLEDTSSTWIVMGPESGLGYFLYANGYDVWMGNVRGN
RYSKGHVKLNPNTDKSYWSFSWHEIGMYDLPAMIDGVLQKTGYQKLSYFGHSQGTTSFFV
MASSRPEYNAKIHLMSALAPVAFMKHMKAPLMGIARMGMNMFGDNFELFPHSEVFLNQCL
SSAAMLKTCMRFYWQIVGKNREEQNMTMFPVVLGHLPGGCNIKQALHYLQMQKSDRFCQY
DYESKENQRLYGRSTPPDYRLERIKAPVALYYGSNDYLSAVEDVHRLAKVLPNVVENHLY
RKWNHMDMIWGISARRSIQPRILQVMQYWETGGGGTKDGTTGSPVEEDVPQLTTETPIEE
GTTQGDEKIGNVQGNEEQGHAEETEQVQVTTSPTSEL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgccacatgcgatctgcattctcgtagtgctcgggatctatacgctcgatggatccggg
gtgttgggcgggttcatggagaacacctacccggcaagcgtgattgaggatgctcacctg
aatacgatacaactactggaaaagtacaagcatccagcggagacccaccaggtgaccacc
gatgataaatatatccttacccttcatcgcatagctcgacctggagccaagccagttctg
ctggttcacggactggaggacacctcttccacttggatcgtaatgggtcccgaaagtggc
ctgggttactttctctacgccaacggatacgacgtctggatgggtaatgtcagggggaat
cgttactccaagggccacgtgaaactcaaccccaatacggacaagtcctactggagcttc
tcttggcacgagattggcatgtacgatctgccagcgatgatcgatggagttctgcagaaa
acaggataccaaaagctgagctacttcggtcactcccagggaaccacctcgttcttcgta
atggcttccagtagacccgagtataatgcgaagatccatttgatgagcgctctggcaccc
gtggcctttatgaagcacatgaaggcaccacttatgggaatagcccgcatgggaatgaac
atgtttggcgacaattttgagctgtttccgcactcggaagtatttctcaaccagtgcctt
tcctctgccgccatgctaaagacctgtatgcgattctactggcagattgtaggcaagaat
agggaggagcaaaatatgaccatgttccctgtggttttgggccatcttcccggtggctgc
aatatcaaacaagcgctccactacctccaaatgcaaaaatccgatcgcttctgccagtac
gattacgaatccaaggagaaccaaaggctgtacggacgttccacaccgccggattaccgc
ctggaaaggatcaaggctccggtggccctgtactacggcagtaatgattacctttcggcc
gtggaggatgtacaccgattggccaaagtgttgcctaatgtggtcgagaaccatctgtac
cgcaaatggaaccacatggacatgatctggggcataagtgctaggcgttcgattcaaccc
aggattctacaagtgatgcagtactgggaaacaggaggaggaggaaccaaggatggcact
actggttcacccgtggaagaggatgtgccccagctgacaacggagactccgatcgaggaa
ggaacaactcaaggggacgagaaaattggcaatgtccagggaaatgaggagcaaggtcat
gctgaagaaactgagcaggttcaagttaccaccagtcctacctcggaactatag

DBGET integrated database retrieval system