KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7393
Entry
Dmel_CG7393       CDS       T00030                                 

Gene name
p38b
Definition
(RefSeq) p38b MAP kinase
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG7393 (p38b)
   04068 FoxO signaling pathway
    Dmel_CG7393 (p38b)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG7393 (p38b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG7393 (p38b)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmel_CG7393 (p38b)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dmel_CG7393 (p38b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 FTA2
Other DBs
NCBI-GeneID: 34780
NCBI-ProteinID: NP_477361
FlyBase: FBgn0024846
UniProt: O61443
Position
2L
AA seq 365 aa
MSRKMAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQ
SAVHAKRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNII
RTQKLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAES
EMTGYVATRWYRAPEIMLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIME
VLGTPADEFMSRISSESARNYIRSLPVMPRRNFRDIFRGANPLAIDLLEKMLELDADKRI
TAEQALAHPYMEKYHDPTDEQTAALYDQSFEENELPVEKWREMVFSEVTAFKPTAAFAEL
LPKEQ
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcgcgcaaaatggccaaattctacaagctggacatcaatcgcaccgagtgggaaatc
ccggaaacataccagaacctgcaacccgtgggtcagggtgcctacggccaggtctgcaag
gccgtggtccgcggaaccagcacgaaggtggccatcaagaagcttgccaggcccttccag
tcggcggtccatgcgaagcgcacctatcgggaactgcggctgctgaagcacatggatcac
gagaacgttattggtctgctggatgtctttcatccaggacagcccgccgattcgctggat
cagttccagcaagtgtacatggtgacccacttgatggacgccgatctgaacaacataata
cgcacgcagaaactgtctgatgatcatgtccagtttctggtctaccaaatcctgcgcggt
ctgaagtacatccacagcgctggggtcatccatcgtgatctaaagccatcgaacattgcg
gtaaacgaggactgtgagcttcgcatcctggatttcggtttggcccgtcccgcagaaagc
gagatgaccggatacgtcgcaacgcgatggtaccgggcgcctgagatcatgctcaactgg
atgcactacaaccagacggcggacatctggtcggtgggctgcatcatggctgagctgctg
actgggcgcacgctgttccctggaaccgatcacatccatcagctgaacctcatcatggaa
gtgctgggcacgccagctgatgagttcatgagccgcatctcctcggagagcgctagaaac
tatattcgttcactgccggtgatgccgcgccgcaatttccgcgacatcttccgcggtgcc
aatccgctggccatcgatttgctggagaagatgctggaacttgacgccgacaagcgcata
accgccgagcaggcgctggcccatccgtacatggagaagtaccacgatccaaccgatgag
cagaccgccgcgctctacgaccagagcttcgaggagaacgagctgccggtggagaagtgg
cgggagatggtcttcagcgaggtgacggccttcaagcccacagccgccttcgctgagctc
ctgcccaaagagcagtaa

DBGET integrated database retrieval system