KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7404Help
Entry
Dmel_CG7404       CDS       T00030                                 

Gene name
ERR
Definition
(RefSeq) estrogen-related receptor, isoform B
  KO
K08703  estrogen-related receptor ERR
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG7404 (ERR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dme03310]
    Dmel_CG7404 (ERR)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    Dmel_CG7404 (ERR)
Nuclear receptors [BR:dme03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   Dmel_CG7404 (ERR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 38912
NCBI-ProteinID: NP_648183
FlyBase: FBgn0035849
UniProt: Q8WS79
Position
3L
AA seq 496 aa AA seqDB search
MKFYAGEGQGTNMSDGVSILHIKQEVDTPSASCFSPSSKSTATQSGTNGLKSSPSVSPER
QLCSSTTSLSCDLHNVSLSNDGDSLKGSGTSGGNGGGGGGGTSGGNATNASAGAGSGSVR
DELRRLCLVCGDVASGFHYGVASCEACKAFFKRTIQGNIEYTCPANNECEINKRRRKACQ
ACRFQKCLLMGMLKEGVRLDRVRGGRQKYRRNPVSNSYQTMQLLYQSNTTSLCDVKILEV
LNSYEPDALSVQTPPPQVHTTSITNDEASSSSGSIKLESSVVTPNGTCIFQNNNNNDPNE
ILSVLSDIYDKELVSVIGWAKQIPGFIDLPLNDQMKLLQVSWAEILTLQLTFRSLPFNGK
LCFATDVWMDEHLAKECGYTEFYYHCVQIAQRMERISPRREEYYLLKALLLANCDILLDD
QSSLRAFRDTILNSLNDVVYLLRHSSAVSHQQQLLLLLPSLRQADDILRRFWRGIARDEV
ITMKKLFLEMLEPLAR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctacgcgggagaaggccaaggcacgaacatgtccgacggcgtcagcatcttg
cacatcaaacaggaggtggacactccatcggcgtcctgctttagtcccagctccaagtca
acggccacgcagagtggcacaaacggcctgaaatcctcgccctcggtttcgccggaaagg
cagctctgcagctcgacgacctctctatcctgcgatttgcacaatgtatccttaagcaat
gatggcgatagtctgaaaggaagtggtacaagtggcggcaatggcggaggaggaggtggt
ggtacgagtggtggaaatgcgaccaatgcgagtgccggagctggatcgggatccgtcagg
gacgagctccgccgattgtgtttggtttgtggcgatgtggccagtggattccactatggt
gtggcgagttgtgaggcttgcaaagcgttctttaaacgcaccatccaaggcaacatcgag
tacacgtgtccggcgaacaacgagtgtgagattaacaagcggagacgcaaggcctgccaa
gcgtgtcgcttccagaaatgtctactaatgggcatgctcaaggagggtgtgcgcttggat
cgagttcgtggaggacggcagaagtaccgaaggaatcctgtatcaaactcttaccagact
atgcagctgctataccaatccaacaccacctcgctgtgcgatgtcaagatactggaggtg
ctcaattcatatgagccggatgccttgagcgtccaaacgccgccgccgcaagtccacacg
actagcataactaatgatgaggcctcatcctcctcgggcagcataaaactggagtccagc
gttgttacgcccaatgggacttgcattttccaaaacaacaacaacaatgatcccaatgag
atactaagcgtccttagtgatatttacgacaaggaattggtcagcgtcattggctgggcc
aagcagatacctggctttatagatctgccacttaacgaccagatgaagcttctccaggtg
tcgtgggcagagatcctgacgctccagctgaccttccggtccctaccgttcaatggcaag
ttatgcttcgccacggatgtctggatggatgaacatttggccaaggagtgcggttacacg
gagttctactaccactgcgtccagatcgcacagcgcatggaaagaatatcgccacgaagg
gaggagtactacttgctaaaggcgctcctgctggccaactgcgacattctgctggatgat
cagagttccctgcgcgcatttcgtgatacgattcttaattctctaaacgatgtggtctac
ttgctgcgtcattcgtcggccgtgtcgcatcagcaacaattgctgcttttgctgccttcg
ctgcggcaggcggatgatatcctgcgaagattttggcgtggaattgcacgcgatgaagtc
attaccatgaagaaactgttcctcgagatgctcgagccgctggccaggtga

DBGET integrated database retrieval system