KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7413
Entry
Dmel_CG7413       CDS       T00030                                 

Symbol
Rbf
Name
(RefSeq) Retinoblastoma-family protein
  KO
K04681  retinoblastoma-like protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Dmel_CG7413 (Rbf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG7413 (Rbf)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    Dmel_CG7413 (Rbf)
SSDB
Motif
Pfam: RB_A DUF3452 RB_B
Other DBs
NCBI-GeneID: 31027
NCBI-ProteinID: NP_525036
FlyBase: FBgn0015799
UniProt: Q24472
Position
X
AA seq 845 aa
MSEPDPQELGAEVVSGLVATSDDRLEMINAEYTNLCRDLNMDRQTELQGYETYLEVSQRC
SMEGTASHWMCCAIYTACRRTSTPTVTGQNAVVKGNCVSLNNLLRCCKMSIYEFKTKIKQ
WCDMANLPQEFVNEIEDLDRKFSITFMLHKRFRIIMDMIFSCPPNEKKHSKYISLHGNHA
HGKCSYIKLDDICWRLFLCAKNQKPSNTVDLVTSYNLMICCIDLIYNNVLAEKRTDLINP
KFEGLPSNWTELDFRHNPHCILSNFCDMTEEAKAMKATTFRQIMSSFFQASTIYGNKDTM
LGLLANENFERNLKSLNISYEQYVLSVGEFDERILSAYDAGEHTALNDQSLRPPVTPLTR
KQDLPAQPAMAGDKFEPVRNATNNVKQLSAFGRITEPTDFVKQAGEEVIAKLLSIIEEIE
QKFLAKYPSTEAKSRFQLAKSFFFYLLDQILQAEIRNKPDIDLKRLLVQKVSLVIFNITL
MACCVELVLEAYKTELKFPWVLDCFSISAFEFQKIIEIVVRHGSHEGCLNRSLIKHLNSI
EETCLERLAWARNSTVWEMIASAQLPLPTWLMVNLDRAAGPLQIFLRKVYLLGWLRIQKL
CSELSLCEKTPESIWHIFEHSITHETELMKDRHLDQNIMCAIYIYIRVKRMEDPKFSDIM
RAYRNQPQAVNSVYREVFIDINEDGEPKVKDIIHFYNHTYVPLMRQFVIDYLNVTPDVSG
RASDLQLSPHPKERAAQPKKVTQSHSLFVSQMSKNEIQQSPNQMVYSFCRSPAKDLQAMN
EKVRGGKRMLSFGDEPGLGTMAETKRSKISQVKAVMDDPELQSAEQQTAVTTEGCVGGEG
GEHET
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgagcgagcctgacccgcaggaactgggagctgaggtggtcagcggattggtggcgacc
agcgacgaccgcctggagatgatcaacgccgagtacacgaacctatgccgggatctaaac
atggatcggcagacagagctgcagggctacgagacgtacttagaggtgtcccagaggtgc
tccatggagggcacagccagccactggatgtgctgcgccatttacacggcctgccgaaga
accagcacacccacggtgactggccagaatgcagtggtcaagggtaattgtgtgtcctta
aacaatttgctgcgctgctgcaagatgagcatctacgagttcaagaccaaaattaagcag
tggtgcgacatggccaacctgcctcaggagtttgtcaacgagattgaggatctggaccgc
aagttcagcattacattcatgctgcacaagcgtttccgcattattatggacatgatcttc
tcgtgcccgcccaacgagaagaagcactccaagtacatttctctgcatggcaaccacgcc
cacggaaagtgctcgtacatcaagctggacgacatctgctggcgcctgtttctctgcgcc
aagaaccagaagccgagcaacaccgtggacctggtgacatcctacaatctgatgatttgc
tgcatagacctgatatacaacaatgtgctggccgagaagcgcaccgatctcatcaacccc
aaattcgagggcctgccgagcaactggacggagctggactttcgtcacaatccgcactgc
attttgtccaacttctgtgacatgaccgaggaggctaaagccatgaaggccaccactttc
cgccagatcatgtcgagcttctttcaggcttcgaccatctacggcaacaaggacactatg
ttaggcctattggctaacgaaaacttcgagcgcaacctaaagtccctcaacatcagctac
gagcagtacgtcctcagcgtcggcgaattcgacgaacgcattctgagtgcctacgatgcg
ggggaacacactgccctcaacgaccagtccctgcgtccgccggttactccgcttacccgc
aagcaagatctgcctgcgcagcccgcgatggctggcgataaatttgagcccgtccgcaac
gccactaacaacgtgaagcagctgagcgccttcggacggatcacagaacccacggacttt
gtcaagcaagctggcgaagaggtaatagccaagctgcttagcatcatcgaggagatcgag
cagaaattcctcgccaagtacccgtcaacggaggcgaagagtcgcttccaactagcgaag
tccttcttcttctacctgctcgaccagatcctgcaggcggaaattcggaacaagcccgac
atcgatctcaagcgactgctggtgcagaaggtctccctggtcatctttaacatcacgctg
atggcctgctgcgtggagctggtgctggaggcctacaaaacggagctcaagttcccgtgg
gtgctcgactgtttcagtattagcgcgttcgagttccaaaagatcatcgagatcgtggtg
cggcacggctcgcacgaaggctgtttgaaccggtcgctgataaagcaccttaactccatc
gaggagacgtgtctggagcggctggcctgggcgaggaactcgaccgtctgggaaatgatc
gcctccgcccaactgccgttgcccacgtggctcatggttaacctcgaccgcgccgccggc
cccttgcagatattcctgcgcaaggtgtacctgcttggctggttgcgcatccagaagctg
tgctcggagctgtcactgtgcgagaagacgcccgagagcatctggcacatctttgagcac
tcgatcacccacgagacggaattgatgaaggaccgccacctcgatcaaaatattatgtgt
gcaatatatatctacataagagtaaagcgaatggaggaccccaagttcagtgacattatg
cgggcatatcgcaaccagccgcaggcggtgaacagcgtctaccgcgaggtgttcatcgac
atcaacgaggacggggagccaaaggtgaaggacatcattcacttttacaaccacacttac
gtgccgctgatgcggcagttcgtcatcgactacctaaacgtaactccggacgtgagtggc
cgggcttcggatctacagctctccccgcatccgaaggaacgggccgcccagcccaagaag
gtaacccagagccactcgctgttcgtgtcgcagatgtccaagaacgagatacagcagtcg
cccaaccagatggtctacagtttttgccgcagccccgccaaggaccttcaggctatgaac
gaaaaggtacgcggcggcaagcgcatgctgagctttggcgacgagcccggactaggtaca
atggcagagacgaagcgctcgaaaatcagccaggtcaaggccgtcatggacgaccctgaa
ctgcagtcagccgagcagcagactgctgttaccacggaaggttgcgtagggggcgaagga
ggagaacacgagacatag

DBGET integrated database retrieval system