KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7425Help
Entry
Dmel_CG7425       CDS       T00030                                 

Gene name
eff
Definition
(RefSeq) effete, isoform B
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04120  Ubiquitin mediated proteolysis
dme04141  Protein processing in endoplasmic reticulum
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG7425 (eff)
   04120 Ubiquitin mediated proteolysis
    Dmel_CG7425 (eff)
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG7425 (eff)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG7425 (eff)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG7425 (eff)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     Dmel_CG7425 (eff)
Ubiquitin system [BR:dme04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   Dmel_CG7425 (eff)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Motif
Other DBs
NCBI-GeneID: 41785
NCBI-ProteinID: NP_001262578
FlyBase: FBgn0011217
UniProt: P25867 A0A0B4KHJ1
Position
3R
AA seq 147 aa AA seqDB search
MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDY
PFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLV
PEIARIYKTDREKYNELAREWTRKYAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaaaaagaatcaataaggaactgcaagatctgggcagagatccacctgcacaa
tgttcagccggtccagttggagatgatttatttcactggcaagctacaataatgggcccg
ccggacagcccttatcaaggaggtgtattcttcttaactatacattttccaacagactat
ccctttaaaccacccaaagtggcttttacaacgcgcatataccatccaaacatcaacagc
aatggatcgatttgtctcgatatattaagatctcagtggtcgccagcattaactatttca
aaagttttattatcaatttgctctctactctgtgatcccaatccagacgatcctcttgtt
ccagagattgccagaatatataaaaccgatcgggaaaaatacaatgagctggcacgagag
tggactagaaagtatgctatgtga

DBGET integrated database retrieval system