KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7438Help
Entry
Dmel_CG7438       CDS       T00030                                 

Gene name
Myo31DF
Definition
(RefSeq) myosin 31DF, isoform C
  KO
K10356  myosin I
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG7438 (Myo31DF)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG7438 (Myo31DF)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG7438 (Myo31DF)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG7438 (Myo31DF)
   04147 Exosome [BR:dme04147]
    Dmel_CG7438 (Myo31DF)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dmel_CG7438 (Myo31DF)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Phagocytosis
   Others
    Dmel_CG7438 (Myo31DF)
 Others
  Actin-binding proteins
   Myosins
    Dmel_CG7438 (Myo31DF)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    Dmel_CG7438 (Myo31DF)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     Dmel_CG7438 (Myo31DF)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG7438 (Myo31DF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_head Myosin_TH1 IQ Zeta_toxin AAA_22 AAA_16
Motif
Other DBs
NCBI-GeneID: 34445
NCBI-ProteinID: NP_001188784
FlyBase: FBgn0086347
UniProt: Q23978
Position
2L
AA seq 1011 aa AA seqDB search
MAMQREAGVQDFVLLDQVSMEKFMDNLRKRFQNGSIYTYIGEVCVSMNPYRQMNIYGPET
IRKYKGRELFENAPHLFAIADSAYRVLKQRQQDTCILISGESGAGKTEASKIIMKYIAAV
TNAQGQNEIERVKNVLIQSNAILETFGNAKTNRNDNSSRFGKYMDIEFDYKADPVGGIIT
NYLLEKSRVVQQQPGERNFHSFYQLLRGANDNELRQYELQKETGKYHYLNQGSMDILTEK
SDYKGTCNAFKTLGFSTDEVQTIWRTIAAVLHLGNVEFQTIEDELVISNKQHLKSTAKLL
QVTETELSTALTKRVIAAGGNVMQKDHNATQAEYGKDALAKAIYDRLFTWIISRINRAIL
FRGSKTQARFNSVIGVLDIYGFEIFDSNSFEQFCINYCNEKLQQLFIELVLKQEQEEYQR
EGIEWTNIEYFNNKIICDLVEQPHKGIIAIMDEACLSVGKVTDDTLLGAMDKNLSKHPHY
TSRQLKPTDKELKHREDFRITHYAGDVIYNINGFIEKNKDTLYQDFKRLLHNSKDANLSE
MWPEGAQDIKKTTKRPLTAGTLFQRSMADLVVTLLKKEPFYVRCIKPNDLKSSTVFDEER
VEHQVRYLGLLENLRVRRAGFVHRQRYDKFLLRYKMISQYTWPNFRAGSDRDGVRVLIEE
KKFAQDVKYGHTKIFIRSPRTLFALEHQRNEMIPHIVTLLQKRVRGWIVRRNFKKMKAAI
TIVRAYKAYKLRSYVQELANRLRKAKQMRDYGKSIQWPQPPLAGRKVEAKLHRMFDFWRA
NMILHKYPRSEWPQLRLQIIAATALAGRRPYWGQARRWVGDYLANSQENSGYEAYNGSIK
NIRNHPADGETFQQVLFSSFVKKFNHFNKQANRAFIVSDSTIHKLDGIKNKFKDMKRTIK
IRELTSISVSPGRDQLIVFHSSKNKDLVFSLESEYTPLKEDRIGEVVGIVCKKYHDLTGT
ELRVNVTTNISCRLDGKARIITVEAASNVEVPNFRPKEGNIIFEVPAAYCV
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcaacgggaagctggagtgcaggacttcgtcctcctcgaccaagtgtccatg
gagaagttcatggataacctgagaaagcgattccaaaacggatccatctacacatacatc
ggcgaagtgtgcgtctcgatgaatccctacagacagatgaacatctacggtccggaaacc
attcgcaaatacaagggtcgggagctcttcgagaatgccccacatttgttcgccattgcc
gattccgcctacagggtgctcaagcagcgccaacaagacacctgcatcctaatttccggt
gagtccggtgcgggcaaaacggaggcctccaagatcatcatgaagtacattgcggcggtg
acgaatgcccagggtcagaacgaaatcgagagagtcaagaacgttttgatccagagcaat
gcaattctggaaaccttcggcaacgcaaagactaaccgcaacgacaactccagccgcttc
ggaaagtacatggacattgagttcgactacaaggcggatcccgtgggtggcatcatcacc
aactatctgctcgagaagtcgcgcgtggtgcagcagcagcccggcgagcggaacttccat
agtttctatcagctgctgcgtggagccaacgacaacgagctgcggcaatatgaactgcag
aaggaaacgggcaagtatcactacttgaaccagggcagcatggacatactgacggagaag
tccgactacaagggcacctgcaatgccttcaagaccctgggcttctccacggatgaggtg
cagaccatttggcgcacaattgccgctgtcttgcatctgggaaatgtggagttccaaacc
attgaggatgagctggtgatcagcaataagcagcacttgaaatccacggccaagctgctc
caggtcaccgaaaccgagctgtccacggcactgaccaaacgggtcattgcggccggtgga
aatgtgatgcagaaggatcacaacgccacgcaggcagagtacggaaaggatgctctggcc
aaggccatctacgaccgtctcttcacctggatcatctcccgcatcaacagggcaatccta
ttccgtggcagcaagacgcaggcgcgatttaactcggtcatcggagtgctggatatttac
ggcttcgagatcttcgacagcaacagctttgaacagttctgcatcaactattgcaacgag
aaattgcagcagttattcatagaactggtgcttaaacaggagcaagaggagtaccagcgt
gagggcattgaatggaccaatattgaatacttcaacaacaagatcatttgcgatctcgtt
gagcagccgcataagggcatcattgccatcatggacgaggcctgcctcagcgtgggcaag
gtgacggacgacacacttctgggggccatggacaaaaatctgagcaagcatccgcactac
accagtcgtcagctgaagcccacggataaggagctaaagcatcgcgaggatttccgtatc
acccactacgccggcgatgtgatctacaacatcaatggattcatcgagaagaacaaggat
acgctgtatcaggactttaagcgcttgctgcacaactctaaggatgccaacctgagcgag
atgtggcccgaaggagcacaggatatcaagaaaaccaccaagagaccattgacagccggc
accttgttccagagatcgatggctgatctggtggttactctgctgaagaaggaacccttc
tatgtgcgctgcatcaagcccaatgaccttaagagctcgacagttttcgatgaggagcgt
gtggagcaccaggtgcgataccttggcctactggagaacttacgtgtccgtcgagccgga
ttcgttcatcgccagcgctatgataagttcctgctgcgctacaagatgatctcgcagtac
acttggcccaatttccgtgcgggaagcgaccgcgatggtgtccgtgtgctgatcgaggaa
aagaaattcgcccaggacgttaagtacggccacacaaagatctttatacgctcgccacgc
accctgtttgccctggagcatcagaggaacgaaatgatcccacatattgtgacgctgctg
caaaagcgagtgcgtggatggattgtgaggagaaactttaagaagatgaaggcggcaatt
acgatcgtgcgcgcctataaggcctacaaactgcgtagctacgtccaggagctggccaat
cgcttacggaaagccaagcagatgcgcgactacggcaagagcatccagtggccacagccg
ccgctcgccggacgtaaggtggaggctaaactgcatcgtatgttcgatttctggcgagcc
aacatgatcctgcacaaatatcctcgcagcgagtggccgcaattacgtctgcagattatc
gccgccactgcgctggccggaagacgaccctattggggtcaagcgcgccgctgggtgggt
gattatctggccaactcgcaggagaacagcggatatgaagcctacaacggaagcataaag
aacataaggaaccaccccgccgacggcgagaccttccagcaagtgctcttctcctcattc
gtcaagaagttcaaccatttcaacaagcaggctaatcgcgccttcatcgtttccgattcg
accatccacaaactggacggtatcaagaataaatttaaggacatgaaacgcaccattaaa
attagggagttgacgtccattagtgtctcacccggccgggatcaactaatcgtcttccac
tcgtcgaaaaacaaggatttagtgttttccctggagagcgagtacacgcccctcaaggaa
gatcgcattggcgaagtggtgggcattgtgtgcaagaaataccatgacctcactggaacc
gagttgcgtgtgaatgtgaccaccaatatttcctgtcgcctagacggcaaggcacgcatt
attaccgtggaggcggcgtccaatgtggaggtccccaacttccgtcctaaagagggcaac
atcattttcgaggtgccggcggcgtactgcgtttag

DBGET integrated database retrieval system