KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7497
Entry
Dmel_CG7497       CDS       T00030                                 

Gene name
CG7497
Definition
(RefSeq) uncharacterized protein, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Phage_tail_X 7TM_GPCR_Srw CoA_binding_3
Other DBs
NCBI-GeneID: 39966
NCBI-ProteinID: NP_001287100
FlyBase: FBgn0036742
UniProt: Q9VVJ1
Position
3L
AA seq 412 aa
METTTPVLDLLMPHNSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFILARKKLNK
NSKYTLMLRCLATNNLVALLGMLTTTLLKMYLSKEVLQSFIRVDCVGLVVWRFFGLSSGC
IAAVMAAERWMALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPD
QLKCIRYRDAPGVWNKTYAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHY
DLVSRDKNSAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSP
VEIKFAKLMAFLSISFVICWMPQMIAIPLAIAPNRVPASNKFFIIADVLTALHFTSDPYV
YVLSRSKSINWSLLGCIKRWRSGWRPGGLRRSQSDQSRMRTTMTEANTLEFN
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggaaaccacaacacctgtgctcgacctgttgatgccgcacaactcaactactgtggcg
cctccgaaagcgctctatgcaaatcgaaatcgcctgattattggtgttattatcatggtt
ctgggcgtttttggcaattcgctggcccttttcattttggcgcgcaagaagctcaacaaa
aacagcaaatacacgctcatgctgcgatgcctggcgaccaacaatctggtggctctactg
ggcatgctgaccacgacgctgctgaaaatgtatctctcaaaggaagtcctgcagtcgttc
atccgagtggattgcgtgggactcgtggtttggcgatttttcgggctcagttctggatgc
attgcagcagttatggcggcagaaagatggatggccctagccagaccctttatctaccac
aagcacattacctacgagctcattcgcaagagcatcaacagcattctgatgatcgccgtg
gtgatcacgttcctgccattcgttggttttggtgcatacatcgatgaatccaatccggac
cagcttaagtgtatacgatatcgcgatgcgccgggcgtgtggaacaagacgtatgcggtg
ctctttatggtcttcggtaccctgctgtgcattgtaatcgtggcctgcaacctcttcgtg
gcccacaccttgctctgtgtgatcggaaggagtcgcacggccaagcggcatatgcactac
gacctggtttccagggacaaaaacagtgccatcagcatcgatcccgagagcagcagcggc
accaccctctaccagacgcagctgagcaccggaagcggaaacagccatcgcagtgtacag
ccggcaaggcagtacaggcacagcgttagcgtcacaatggcggccaccgactcctcgcca
gtcgagatcaagttcgccaaactaatggcgttcctcagcatctcgttcgtcatctgctgg
atgccacagatgatcgccatcccgttggctatagctccaaatcgggtgcccgcatcgaac
aagttcttcatcatcgccgatgttcttacggcgctgcacttcacctcggatccgtatgtc
tatgtgctgagtcgctccaagtccatcaactggtccttgctgggatgcattaagcgctgg
aggagcggatggcgtccgggcggacttcgtcgttcccagagcgaccagagccgcatgcgt
acgacgatgacggaggcgaatactctggaattcaactga

DBGET integrated database retrieval system