KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7499
Entry
Dmel_CG7499       CDS       T00030                                 

Symbol
Rh50
Name
(RefSeq) Rh50, isoform B
  KO
K06580  ammonium transporter Rh
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG7499 (Rh50)
   04090 CD molecules [BR:dme04090]
    Dmel_CG7499 (Rh50)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   Dmel_CG7499 (Rh50)
CD molecules [BR:dme04090]
 Proteins
  Dmel_CG7499 (Rh50)
SSDB
Motif
Pfam: Ammonium_transp
Other DBs
NCBI-GeneID: 38589
NCBI-ProteinID: NP_001261434
FlyBase: FBgn0028699
UniProt: M9PEN8
Position
3L:4910368..4920198
AA seq 460 aa
MHSPAAKVSGYVVLMIVQIIFLVLFWLFVRYEKTALPLAIDAEDAGSANEHVSKYPQFQD
IQVMIFIGFGFLMTFLRKYGYSATGFTLFMAALVVQWAVLMKGFLHMEGGKISLSLENII
DADIAAAVPLISMGALLGRTTPIQLLCMSVFEVALFAANEYLALHVFSICDCGGSITVHA
FGAYFGLAVALMLRPASDQNETGKLEGASYTSDIFAMIGTTFLWVYWPSFNSVLADGAGG
ERAILNTFLSLAAATVTTFVVSALVSHENKLDMVHVQNSTLAGGVAVGTVCNLLLGAHGA
VLIGIIAGTVSVLGYRYLTPWMTANLRLHDTCGVHNLHGMPALISAIASAIYASMATVGE
YQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLFGIAVTLLIAIGGGILTGAVLK
YTNFRNLKKDEHHQDEHYWEVPAAENKEEYELEKVDELLL
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgcattcgccggctgccaaagtgtcgggctacgtcgtcctgatgattgtgcaaataatc
ttcctggttctattctggctgttcgtgcgttacgaaaagacggcgctgcccctggcaatc
gacgccgaagacgctggatcagcaaacgaacacgtttccaaatatccgcagttccaggac
atccaggtgatgatcttcattggctttggcttcctaatgaccttcctgcggaagtacgga
tacagtgccaccggattcaccctgttcatggctgctctagtagtgcaatgggctgtgctc
atgaagggattcctccacatggagggcggcaagatcagcctctccctggagaacatcatt
gatgcggatatagccgccgcggtgcccctgataagcatgggcgctctgctcggcagaacc
acgcccatccaactcctgtgcatgtccgtttttgaggtggctcttttcgcggccaatgag
tatctggctcttcatgtgttcagtatctgcgactgcggcggctctatcactgtccatgct
tttggagcctactttggactggctgttgccctgatgctgagacccgccagcgaccagaac
gaaacgggaaagctagagggcgccagctatacgtcggacatcttcgccatgatcggcacc
accttcctgtgggtgtactggcccagctttaactccgttctggccgacggagccggcggc
gagcgggccattttgaacacgttcctgtcattagccgcggcaacagtgaccaccttcgtt
gtatccgcgcttgtcagccacgagaataaattggacatggtgcacgtgcagaactcgacc
ctcgccggcggagttgccgtgggcacggtgtgcaacttgctgctcggcgcccacggagct
gtcttaattggcattatcgccggcacggtctcggtgctcggctatcgctatttaacaccc
tggatgacggccaatctgaggctgcacgacacctgtggcgtgcacaacctgcacggaatg
cctgccctgatttcggccattgcctccgccatttacgcctcgatggccaccgtgggcgag
taccaatccgagctgcaggacattttcccggccatggtgggcaccaacggaaccgagacc
aaaatcatgggcggtcttggccggaacgctacttcgcaggcgggctaccaattgtttggc
atcgctgtcacactgctcattgccatcggaggtggtattttgacaggtgccgttttgaag
tacaccaacttccggaacctgaagaaggacgaacatcaccaggacgagcactactgggaa
gttccggctgccgagaacaaggaggaatatgaactagaaaaagttgacgagcttttgctt
taa

DBGET integrated database retrieval system