KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7509
Entry
Dmel_CG7509       CDS       T00030                                 

Gene name
CG7509
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 LRR_9
Other DBs
NCBI-GeneID: 38579
NCBI-ProteinID: NP_647931
FlyBase: FBgn0035575
UniProt: Q9VZ84
Position
3L
AA seq 615 aa
MSLGVWQLVSLVLLMDPAEVITGPSQAKEPPIQSLDEFRQRYLLPLISSDTRNCSLNACE
SLGIVSQLLMLINSMPNGTQSAANDKKPPKSKANGHNDGDVNGGEINAMSHLANFDLVKR
VRQIESRLRSVEQPVWHLATGSQIEWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIP
MNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQ
LEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQ
LMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNR
ISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNV
SALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNK
LMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLG
GHEVGLLRYDDLCDGQWASMLSLSPRLPVRKHQISTPMNYTDYFNLYLKHIYNGTTDEEL
KEADITSVSIKKVHN
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgtcgcttggagtatggcaactagtcagcttagtcttgctgatggatccggccgaggtg
atcacaggaccttcacaggcaaaggagccgcccatccagagtctggatgagttccggcag
aggtacctgctccctctcatttcctcggacacaagaaactgcagtctgaatgcatgtgaa
tcactgggtattgtatcccagctattgatgcttatcaactcaatgccaaatggaacccag
tccgctgcgaacgataaaaaaccacctaagtccaaggcgaatggacataatgatggagat
gtcaatggcggtgagattaatgccatgtcccatttggccaactttgatctggtgaagcgg
gtgcgacagatcgagagtcgactacgatccgtggagcagcccgtctggcacttggccact
ggcagccaaatcgagtggaatcactgcacctcaggcgtgtgtcgctgcaatccggacacc
aagagcttcacctgctggaataccaatcttaaatcagtgcctgtcactcaggtgataccc
atgaatatggtcaacatagatctttcgcggaacatcctttccaccctgcacaaggatacc
tttcgaggactaaccgtgcttaaagagttggatatatcgcacaatgttttggattttctg
cccttcgatttgtttcaggatctggatagtctcttggttttgcgcattcaaaacaatcaa
ctggaggatattgatcatcgtaccttctggaagctacgaaacctgaatattctggatctg
agtaaaaacgagataggaatgctgcccgaatcaatattttaccatgcccaaaggctcacc
gtgattaatatgtgcgacaatcagattcagaactttccacccaacctcctgcgagatcag
ctgatgctagaggagctggatatgtctagaaacaaaatcagcgagcttagttcgggcagc
attagatatctgaccaagctgaagaccctggactttggatggaatcaaatagctaagatt
gatgatgacttctttgcgggactaaggagtctacgaactctttcgctgcataacaatcgc
atctcatcgctgtcgggaaccatattcaataatttggccaatttggtcacccttgatttg
accacgaatcggataagtcatatagatggcaatgcctttgtggagctgaacaatctaaat
gaattatttttgggccagaactccatgtccagcattccagctgatctattcctgaatgtt
agtgccctcacacgcttgaccctattttccaataacctaaccaccttggaagccgatgac
ttccaagggttaaataacctaaagattttgttgcttaacaataacatacttaaaaatttc
gatgcccgcgctttcgagccgctttcacaattggaaaaactccgcattgactccaacaag
ctgatgtttctgccgcatggagctcttcatggcctgaaaaatttggtggccgtcaaactg
gacaagaatccctggcactgcgattgccgagctctatatttggccaggtggatacgagag
tttgtgctgaaactctgggacggacagcagcccatgtgccgtggtcctggcgatttggga
ggtcacgaggtgggactactgcgttatgatgacctctgcgacggccagtgggccagcatg
ttgtccctttcgccacggcttccagttcgaaagcatcaaatatccacaccgatgaactac
acagactacttcaatctgtatctgaagcacatctacaatggcactacagatgaggagctc
aaggaggccgatataaccagcgtgtccatcaagaaggttcataactag

DBGET integrated database retrieval system