KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7650Help
Entry
Dmel_CG7650       CDS       T00030                                 

Gene name
CG7650
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: Phosducin Peptidase_C13
Motif
Other DBs
NCBI-GeneID: 39694
NCBI-ProteinID: NP_648786
FlyBase: FBgn0036519
UniProt: Q9VUR7
Position
3L
AA seq 276 aa AA seqDB search
MATLEDKLLGEKLEYYCSSSEGEDNGDEGGDNKGASGKSRCSGLTIDTNPDATPAGGFRQ
QSSTNTGPKGVVKDWQRFKQLEAERRDETERQRLALAKKLTITATTSAEDEERKRQEELD
AELDELMSEDFLQQYQKQRMAEMLRQTGHHQQFGQVQQLTSHEEFLACVEQENKHTTIII
HIYERQLAACATLNKCLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVYKAQAVI
GNFVRLTDDLSDDFFASDVESFLIEHGIIVDRALYN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggccactttggaagacaaactattgggcgagaaacttgagtactactgcagcagcagc
gagggcgaggacaatggtgacgagggaggcgataataagggggcatccgggaaatcccga
tgctccggtctgaccatcgacacaaatccggatgcgactccggctggtggattccggcag
caaagctcaacgaacacgggtcccaagggcgttgtaaaggactggcagagattcaagcag
ctcgaggcggagcgacgggatgaaaccgaacgtcaacgtctggcgctggccaagaagctc
accattacggcgacaacgtcggcggaggacgaggaacgcaagcggcaggaggaactggac
gccgagctggacgaactgatgagcgaggacttcctgcagcagtaccagaaacagcggatg
gccgagatgctgcgccagacggggcaccaccagcagtttggccaggtgcagcagttgacc
agccacgaggagttcctcgcctgcgtcgagcaggagaacaagcacaccaccatcatcatc
cacatatacgaacgacaattggccgcctgtgccacgctgaacaaatgccttgacagtctg
gccagcgattatccgtccattaagttcgccaagatctgcagttccgtggccggaatgagc
agggacttccgcaccaaaggattgcccgccctactggtatacaaggcccaagcggtcatc
ggaaactttgtgcggcttaccgatgacctcagcgatgacttcttcgcctccgacgtcgag
agttttctgattgagcacggcattatagtggacagagctctgtacaattga

DBGET integrated database retrieval system