KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7786Help
Entry
Dmel_CG7786       CDS       T00030                                 

Gene name
CG7786
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 Npa1 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 36802
NCBI-ProteinID: NP_611101
FlyBase: FBgn0034096
UniProt: A1ZAC2
Position
2R
AA seq 192 aa AA seqDB search
MHSPAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSE
TLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDAKY
FERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLLGAT
TAGGMLSMARQV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcactcgcccgcccagtcgcccattttggatgtcaccgagaccgtatcgatgcactcc
gaactggatgcggaactggagtccaagaacaatccgtcctactccatttccattccccag
aatcttcggctaaccggtctgggctttcccggcatgatcggtgccaagagatcgtcggaa
actctacccgccttcgagtatatcgcaccaccaagtcacgctctccaggcactggaattt
ccgctgatggagctcaatcgtgtgggcgtaattggaggcggtatgtttccgggttttgtg
caccgtcgcgtccgcggtgaaaagcgacccattccggaggctcaaaaggatgccaagtac
tttgagcggcgcaagcgaaacaacgaggcggccaagaggtccagagatgcgcggaaaatc
cgcgaggataggatagcattccgagcagcgctgctggagcaggagaactccattctgcgg
gcgcaggtcctggcgctgcgggatgaactgcaaacggtgcgccagctcctcggagccaca
acagccggcggcatgttgtccatggccaggcaggtgtga

DBGET integrated database retrieval system