KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7788
Entry
Dmel_CG7788       CDS       T00030                                 

Gene name
Drice
Definition
(RefSeq) death related ICE-like caspase
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
dme04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG7788 (Drice)
   04215 Apoptosis - multiple species
    Dmel_CG7788 (Drice)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG7788 (Drice)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     Dmel_CG7788 (Drice)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C14: caspase family
   Dmel_CG7788 (Drice)
SSDB
Motif
Pfam: Peptidase_C14 RNase_H_2
Other DBs
NCBI-GeneID: 43514
NCBI-ProteinID: NP_524551
FlyBase: FBgn0019972
UniProt: O01382
Structure
PDB: 
3SIR 3SIP

Position
3R
AA seq 339 aa
MDATNNGESADQVGIRVGNPEQPNDHTDALGSVGSGGAGSSGLVAGSSHPYGSGAIGQLA
NGYSSPSSSYRKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCE
NLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDT
QYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQTETDGDSSMSYKIP
VHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFE
SCTPDTPEMHQQKQIPCITTMLTRILRFSDKQLAPAGRV
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggacgccactaacaatggagaatccgccgaccaggtgggcatcagggtgggcaatccg
gagcagcccaacgatcacacagatgccctgggctccgtgggatccggaggagcgggtagc
agcggcctggtcgcaggatcctcgcatccttacggcagcggagccattgggcagctggcc
aacgggtacagctcaccctcgtccagctaccgtaagaatgtagccaaaatggtcaccgac
cgccatgcagccgagtacaacatgcgccacaagaaccgcggaatggcactgatcttcaac
catgagcacttcgaggtgcccaccttgaagtctcgcgcgggaaccaatgtggactgcgag
aatctgactcgggtgctcaagcagctggacttcgaagtgaccgtgtacaaggactgccgc
tacaaggacattttgaggacaatcgagtatgcagcgtcgcagaatcacagcgatagtgat
tgcatcctggtcgccatcctgtcgcacggcgagatgggctacatctacgccaaggacaca
cagtacaagctggataacatctggagcttcttcacggccaatcactgcccctcgctagcc
ggcaaacccaagttgttcttcatacaggcctgccagggcgacagattggatggcggagtg
accatgcagcgttctcagacggaaaccgatggcgactcctcgatgagctacaagattcca
gtgcacgccgactttctgatcgcctactcgacggttcctggattctattcgtggcgcaac
accacccgcggcagctggttcatgcagagcctgtgcgccgaactggcggccaatggcaag
cggctggacatcctgaccctgctcacattcgtgtgccagcgggtggccgtggactttgag
tcctgcaccccggacactccggagatgcaccagcagaagcagataccctgcataaccacc
atgctgacgcgcattctgcgtttcagcgacaagcagttggcaccagccggacgggtttga

DBGET integrated database retrieval system