KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7820Help
Entry
Dmel_CG7820       CDS       T00030                                 

Gene name
CAH1
Definition
(RefSeq) carbonic anhydrase 1
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00910  Nitrogen metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Dmel_CG7820 (CAH1)
Enzymes [BR:dme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     Dmel_CG7820 (CAH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 34786
NCBI-ProteinID: NP_523561
FlyBase: FBgn0027844
UniProt: Q9V396
Position
2L
AA seq 270 aa AA seqDB search
MSHHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKS
LVNPGYCWRVDVNGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELH
LVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAGNHHAELDKVTSLLQFVLHKGDRVTLPQG
CDPGQLLPDVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEEC
PCNEFNGKVINNFRPPLPLGKRELREIGGH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccactggggatacaccgaagagaacggacctgcccactgggccaaggagtac
ccacaggcgtcgggacatcgtcagtcgcccgtggatatcacaccctccagcgccaagaag
ggcagcgaactgaatgtagctccgctcaagtggaagtatgtgccggagcacaccaaaagc
ctggtcaatcctggctattgctggcgcgtggatgtgaacggcgccgactccgagctgact
ggaggaccgctgggcgatcagatctttaagctggagcagttccactgccactggggctgc
acggactccaagggatcggagcacaccgtcgacggcgtgtcctattccggcgagctgcat
ttggttcactggaacaccacgaagtacaagtcgtttggcgaggcggctgccgctcccgac
ggcctggccgtgctgggtgtgttccttaaggctggcaatcaccatgccgaactggacaag
gtgaccagcctgctgcagttcgtgctgcacaagggcgatcgcgtcaccctcccccagggc
tgtgatcccggccagctgctgcccgatgtgcacacctattggacctatgagggttccctg
accactccaccgtgctcggagtcggtcatctggatcgtgttcaagacgcccatcgaagtg
tccgacgaccagctgaacgccatgcgcaatctcaatgcctacgacgtgaaggaggagtgc
ccctgcaacgagttcaacggcaaggtcatcaacaacttccgtcctccgctgccgctgggc
aagcgtgagctgcgcgagatcgggggccactaa

DBGET integrated database retrieval system