KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7850Help
Entry
Dmel_CG7850       CDS       T00030                                 

Gene name
puc
Definition
(RefSeq) puckered, isoform B
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG7850 (puc)
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG7850 (puc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG7850 (puc)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dmel_CG7850 (puc)
    3.1.3.48  protein-tyrosine-phosphatase
     Dmel_CG7850 (puc)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    Dmel_CG7850 (puc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 40958
NCBI-ProteinID: NP_001287223
FlyBase: FBgn0243512
UniProt: A0A0B4LHX7
Position
3R
AA seq 369 aa AA seqDB search
MNGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQS
PNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIA
IAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPS
NPSSSSVGLSTQSSQLVEQPEEEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSLAG
SNCSSRLTSPPITPDDEAPSTSAAASSVSELDSPSSTSSSSGICSLLQSTSSSVSPRAIS
KPNLLSPTRQLALFKRNSPAKLRLDLESSYAPASPIPNTMPWLSVPSTPVCEEAPDSRIN
HVASNLTRD
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcggcggacggacgccggcgctaacccgcagctgctccagtccggcggtctac
gatatagaaacacaccccgcctcgcccgttttcccgcatctattgctgggcaatggacgc
gacgccgacgatcccagcagcgtgggcgccaactgtgtgctgaacgttacctgccaaagt
cccaatgagagccatctgcagggcctcaagtacatgcaaatacctgccagcgatacgcca
catcagaacatcaagcagtacttccaggaggcctacgactttatcgaagatgcacggaaa
acgggttcccgagtgctgctgcactgccacgcggggatttcgcggagcgccaccattgcc
atcgcctacgtcatgcggtacaagtcgctctccctgctggaggcctacaagctggtgaaa
gtggcccggccgatcatctcgcccaatctgaacttcatgggccagctgctggagctggag
cagaatttgcgcaagagcggagtcctggcgcccgcaaccccgcacctgaatagtcctagc
aatccttcgtcatcttctgtgggattaagcacccaatctagtcaactggtggagcagcca
gaggaggaggagaagcgggaacagcgggaacggggtaaatccaagtcggatagcgaggct
atggacgaggatgggtttgattacgatgatgtggacagcggctccggcagcctggcgggt
agtaactgctcatccagattgacctcgccgccaattaccccggatgacgaggcgcccagc
acttcggcggcagcgtcgtcggtttcagaactagattcacccagctccacaagcagcagc
agtggcatctgctcactgctgcagtccaccagctcatccgtatcaccccgcgcaatcagc
aagccaaatctgctgtcacccacgcggcagttggctctgttcaagcggaattcgcccgcc
aaactgcgattggatctggagtccagctatgcgcctgcgtcacccatcccaaacaccatg
ccctggctttcggtgccatcgacgcccgtctgcgaggaggcaccggatagcaggattaac
catgtggctagcaatttgacgagggactga

DBGET integrated database retrieval system