KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7891
Entry
Dmel_CG7891       CDS       T00030                                 

Gene name
Arl8
Definition
(RefSeq) ADP ribosylation factor-like 8, isoform B
  KO
K07955  ADP-ribosylation factor-like protein 8
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG7891 (Arl8)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dme04031]
    Dmel_CG7891 (Arl8)
Membrane trafficking [BR:dme04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   Arf GTPases
    Dmel_CG7891 (Arl8)
GTP-binding proteins [BR:dme04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl8
    Dmel_CG7891 (Arl8)
SSDB
Motif
Pfam: Arf Ras Roc G-alpha Gtr1_RagA MMR_HSR1 SRPRB
Other DBs
NCBI-GeneID: 40961
NCBI-ProteinID: NP_001287225
FlyBase: FBgn0037551
UniProt: Q9VHV5 A0A0B4LGT4
Position
3R
AA seq 186 aa
MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKI
TRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQL
AGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQH
SKSQSR
NT seq 561 nt   +upstreamnt  +downstreamnt
atgttggccctcatcaacaggatcctcgagtggttcaagagcatcttctggaaagaggag
atggaactcacgctagtggggctgcagttctccgggaagacgacgttcgtcaatgttatt
gcatccggccaattcgctgaggacatgatacccacagttggattcaacatgcgcaagatc
accagaggcaatgtgactatcaaggtgtgggacatcggaggccaacctcgattccgatcc
atgtgggagcgctattgtcgcggcgttaatgcgattgtctacatggtggacgcagccgat
ctggacaaattagaggcctcgaggaacgagctgcactcactgttggacaaaccgcagctc
gccggcattccagttctcgtgctgggcaataaacgagatcttccaggcgctctcgatgaa
accggactcatcgaacgaatgaatctatcgagcatacaggaccgtgaaatctgctgttat
agtatttcctgcaaggagaaggacaacattgacatcacgctgcagtggttaattcaacat
tcgaaaagccaaagtcgttag

DBGET integrated database retrieval system