KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7893
Entry
Dmel_CG7893       CDS       T00030                                 
Symbol
Vav
Name
(RefSeq) Vav guanine nucleotide exchange factor, isoform A
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: RhoGEF CH SH2 C1_1 CAMSAP_CH PH_10 SH3_1 SH3_9 SH3_2 PH IQ_SEC7_PH SH2_2 C1_2 zf-RING_15
Other DBs
NCBI-GeneID: 32920
NCBI-ProteinID: NP_573372
FlyBase: FBgn0040068
UniProt: Q9NHV9
Position
X:19261820..19273280
AA seq 793 aa
MASSSSSNSFGGVAGVNGDLWRECVAWLTRCKVIPPDHKAAQPDAEIRILAMTLRDGVLL
CNLVIHLDPSSLDPREFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDADLFEPTMLYDLT
NFHRVLITLSKLSQCRKVQQLHPDLIGFNLQLSPTERSHSDEAIYKDLHSTTTDNIACNG
TGYDHTNTKEEEVYQDLCALHRTSRSQTASSTSFEQRDYVIRELIDTESNYLDVLTALKT
KFMGPLERHLNQDELRLIFPRIRELVDIHTKFLDKLRESLTPNAKVKMAQVFLDFREPFL
IYGEFCSLLLGAIDYLADVCKKNQIIDQLVQKCERDYNVGKLQLRDILSVPMQRILKYHL
LLDKLVKETSPLHDDYRSLERAKEAMIDVSQYINEVKRDSDHLVIIQKVKDSICDIHLLQ
NGNGSDLLQYGRLLLDGELHIKAHEDQKTKLRYAFVFDKILIMVKALHIKTGDMQYTYRD
SHNLADYRVEQSHSRRTIGRDTRFKYQLLLARKSGKTAFTLYLKSEHERDKWRKALTEAM
ESLEPPGCQSTDHKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTGR
CKQNPVSVPPPVCDRQLSEFNWFAGNMDRETAAHRLENRRIGTYLLRVRPQGPSTAHETM
YALSLKTDDNVIKHMKINQENSGDSMLYCLSSRRHFKTIVELVSYYERNDLGENFAGLNQ
SLQWPYKEVIATALYDYEPKAGSNQLQLRTDCQVLVIGKDGDSKGWWRGKIGDTVGYFPK
EYVQEQKLASEEL
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggccagcagcagtagcagcaacagttttgggggcgtggccggcgtgaacggggatctg
tggcgcgagtgcgtcgcctggctgaccaggtgcaaggtcattccgcccgaccacaaggcc
gcccagccggacgccgagatccgcatcctggcgatgacgctgcgcgacggcgtgctgctc
tgcaacctggtcatccacctggaccccagcagcttggatccgcgcgagttcaatcgcaag
ccgcaaatggcacagttcctgtgcagcaagaacatcaagttgttcctggacgtgtgccac
aacaacttcgggatccgggacgccgatctcttcgagccgacaatgctgtacgacctgacc
aacttccaccgtgtcctcatcacgctctccaagttgtcgcagtgccgcaaggtgcagcaa
ctgcatccggatcttattggcttcaacctacagctttcgcccacggagcgttcccattcg
gacgaggccatctacaaggacctgcattccactaccaccgacaatattgcatgcaatgga
accggttacgaccacaccaacacaaaagaggaggaggtgtaccaagacctgtgcgccctg
cacaggacgagtagaagccagaccgcctcgtcgacgagctttgagcagcgcgactatgtc
atccgcgagctgatcgacacggagtccaattacctggacgttctcactgcgctgaagacc
aagtttatgggtccgctggagcggcatctcaaccaggacgagctgcgtctcatattcccg
cgcatcagagagctggtcgacatccatacaaagttcctggacaaactaagggaatcgctg
acgcccaatgccaaagtgaagatggcccaggtgtttctcgacttccgcgaacccttcctc
atctacggcgagttctgctccctcctgctgggcgccattgactatttggcggatgtgtgc
aagaagaaccagatcatcgatcagctggtgcagaagtgcgagcgggactacaatgtgggc
aaactgcagctacgtgacatactctcagtgcccatgcagcgcattctcaagtaccatctg
ctgctggacaagctggtgaaggagacatcgccgctgcacgacgattaccgctcgctggag
cgggccaaggaggcgatgatagacgtgtcgcaatatatcaacgaggtgaaacgcgactcc
gatcacctggtcatcatacagaaggtgaaggacagcatctgcgatattcatctgctgcag
aatggcaacggcagcgatctgctgcagtacggccgcctgcttctcgacggtgagctgcac
attaaggcgcacgaggaccagaagaccaagctgcgatacgccttcgttttcgacaagatc
ctcatcatggtgaaggcgctgcatatcaagacgggcgacatgcagtacacctaccgcgac
tcccacaacctggccgactatcgcgtggagcagagccattcgcgacgcactattggccgc
gatacgcgattcaagtaccagctcctcctggcccgcaagtcgggcaagacagccttcact
ttgtacctgaaatcggagcacgagcgggacaagtggcgcaaggcgctcaccgaggccatg
gaaagcctggaaccgcctggctgccaaagcacagaccacaaaatggagatctacacgttt
gacgccccgacaacgtgccgtcactgctccaagttcctcaagggccgcatccaccagggc
tatcgatgcaaggtgtgccagatcagcgtgcacaagggctgcatctcgtcgacgggtcgc
tgcaaacagaatccggtaagtgtgccgccacccgtctgcgatcgtcagttgtccgagttc
aattggtttgcgggcaacatggatcgggagacggcggcccaccggctggagaaccggcgc
ataggcacctacctgttgcgagttcgtccgcagggcccatccactgcccacgagacgatg
tatgcgcttagcctaaagaccgatgataatgtgatcaagcacatgaaaatcaaccaggag
aactccggcgactccatgctgtactgcttatcctcgcgaaggcatttcaagaccattgtc
gagctggtctcctattatgaacgcaacgatctgggcgagaactttgcggggctcaatcag
tcgctgcagtggccctacaaggaggtgatcgccaccgctctctacgactacgaaccaaag
gcgggcagcaatcagctgcagctgcgcactgactgccaggtgctggtcattggcaaggat
ggggacagcaagggctggtggcgtggcaaaatcggcgatacggtgggctactttcccaag
gagtatgtgcaggagcagaaattggccagcgaagagctttga

DBGET integrated database retrieval system