KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7923Help
Entry
Dmel_CG7923       CDS       T00030                                 

Gene name
Fad2
Definition
(RefSeq) Fad2
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme01040  Biosynthesis of unsaturated fatty acids
dme01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dmel_CG7923 (Fad2)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dmel_CG7923 (Fad2)
Lipid biosynthesis proteins [BR:dme01004]
 Desaturase
  First
   Dmel_CG7923 (Fad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 44006
NCBI-ProteinID: NP_651966
FlyBase: FBgn0029172
UniProt: Q9VTD4
Position
3L
AA seq 355 aa AA seqDB search
MPRNTKDTTGVLYESDVETVDGGLSTELSNRKTTDGSKLELVWVNIVLFVILHISSLYGV
WLLFTSATWTTVVLFWPTVVVTILGVSGGAHRLWAHRTFKANTPLKLIFLFLNTLAFQDA
VYYWARDHRVHHKYTETDADPYNSQRGWFFAHIGWLCCRKHPEVVEKGKQIDLSDLEADP
LIMFQKKYYLLLMPIICFVLPTVLPMYLWGESLNVSWHVMALLRWCLSLNLIWTVNSSAH
MHGMRPYDKNICPVDQGFLIFFRVGEGYHNYHHVFPWDYKSAELGKYSQDVTTKFIEFMA
YLGWAYDLKSVSLDLVKQRVQRSGDGSHPVWGWGDKDQLKEDVGVTTITHQRNEK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcaataccaaagacaccaccggagtgctttacgaatccgatgtcgagacagta
gacggtggattgtcgacggagctaagcaatcggaagaccaccgatggaagtaaactggag
ttggtatgggtcaatatagtgctgttcgtgatccttcacatatcttcgctatatggagtc
tggctgctcttcacttcggccacgtggacaacggtcgtgctcttttggccaacggttgtg
gtgaccattttgggagtttccggcggtgcccatcgtttgtgggctcatcgcacattcaag
gcgaatacaccgctcaagctgatctttttgttcctgaacactttggcctttcaggatgcg
gtctactattgggcccgggatcatcgcgtccaccacaagtatacggaaactgatgcggat
ccgtacaattcgcaacgtggttggttctttgcccacatcggttggttgtgctgccgcaag
catccggaggttgtggagaagggcaagcaaatagatctatccgatctggaggcagatcca
ctgatcatgttccagaagaaatactacctgctgctaatgccaatcatttgctttgtcctg
cccaccgttttgcccatgtatctgtggggcgaatcactcaatgtgtcctggcacgtgatg
gccctgcttcgatggtgcctcagtctcaatctcatctggacggtcaatagctcggcccac
atgcacggcatgcggccttacgacaagaacatatgtccagtcgatcagggcttcctcata
tttttccgtgtgggtgagggataccacaactaccaccatgtctttccctgggactacaag
agcgccgagctgggcaagtattcgcaggatgtgaccaccaagtttatcgaattcatggcc
tatttgggttgggcctacgatctaaagagtgtctcactggatttggtcaagcagcgagtc
cagcgctctggcgatggatcacatcctgtttggggttggggcgataaggatcaattaaag
gaggacgtgggcgtgaccaccattacccaccagcgaaatgaaaagtaa

DBGET integrated database retrieval system